SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0072150 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0072150
Domain Number 1 Region: 4-130
Classification Level Classification E-value
Superfamily NTF2-like 1.42e-38
Family NTF2-like 0.0000806
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072150   Gene: FBgn0028411   Transcript: FBtr0072241
Sequence length 133
Comment pep:known chromosome:BDGP5:2R:19698844:19699496:-1 gene:FBgn0028411 transcript:FBtr0072241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSDLKAKVESCARTADTFTRLYYASVDNRRQQIGRLYLDNATLSWNGNGAIGRQMIESY
FQELPSSNHQLNTLDAQPIVDQAVSNQLAYLIMASGSVKFADQQLRKFQQTFIVTAENDK
WKVVSDCYRMQEV
Download sequence
Identical sequences A0A1B2AKG3 Q9V3H8
FBpp0072150 FBpp0072150 NP_611833.1.81976 7227.FBpp0072150 FBpp0072150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]