SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0075206 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075206
Domain Number 1 Region: 292-386
Classification Level Classification E-value
Superfamily TAFH domain-like 8.5e-33
Family TAFH domain-like 0.00034
Further Details:      
 
Domain Number 2 Region: 711-760
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000000136
Family TBP-associated factors, TAFs 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075206   Gene: FBgn0010280   Transcript: FBtr0075449
Sequence length 921
Comment pep:known chromosome:BDGP5:3L:16106890:16114468:1 gene:FBgn0010280 transcript:FBtr0075449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTSQTAAGNRITFTSQPLPNGTISIAGNPGAVISTAQLPNTTTIKTIQAGIGGQHQGLQ
QVHHVQQQQQSQQQQQQQQQTQSAGQPLLNSMLPAGVVVGMRQQAPSQQQQKNVPTNPLS
RVVINSHMAGVRPQSPSITLSTLNTGQTPALLVKTDNGFQLLRVGTTTGPPTVTQTITNT
SNNSNTTSTTNHPTTTQIRLQTVPAAASMTNTTATSNIIVNSVASSGYANSSQPPHLTQL
NAQAPQLPQITQIQTIPAQQSQQQQVNNVSSAGGTATAVSSTTAATTTQQGNTKEKCRKF
LANLIELSTREPKPVEKNVRTLIQELVNANVEPEEFCDRLERLLNASPQPCLIGFLKKSL
PLLRQALYTKELVIEGIKPPPQHVLGLAGLSQQLPKIQAQIRPIGPSQTTTIGQTQVRMI
TPNALGTPRPTIGHTTISKQPPNIRLPTAPRLVNTGGIRTQIPSLQVPGQANIVQIRGPQ
HAQLQRTGSVQIRATTRPPNSVPTANKLTAVKVGQTQIKAITPSLHPPSLAAISGGPPPT
PTLSVLSTLNSASTTTLPIPSLPTVHLPPEALRAREQMQNSLNHNSNHFDAKLVEIKAPS
LHPPHMERINASLTPIGAKTMARPPPAINKAIGKKKRDAMEMDAKLNTSSGGAASAANSF
FQQSSMSSMYGDDDINDVAAMGGVNLAEESQRILGCTENIGTQIRSCKDEVFLNLPSLQA
RIRAITSEAGLDEPSQDVAVLISHACQERLKNIVEKLAVIAEHRIDVIKLDPRYEPAKDV
RGQIKFLEELDKAEQKRHEELEREMLLRAAKSRSRVEDPEQAKMKARAKEMQRAEMEELR
QRDANLTALQAIGPRKKLKLDGETVSSGAGSSGGGVLSSSGSAPTTLRPRIKRVNLRDML
FYMEQEREFCRSSMLFKTYLK
Download sequence
Identical sequences E1JI11 P47825
NP_001163453.1.81976 NP_001287077.1.81976 NP_524102.1.81976 NP_730109.1.81976 FBpp0075205 FBpp0075206 FBpp0291125 FBpp0075205 FBpp0075206 FBpp0291125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]