SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0075207 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075207
Domain Number 1 Region: 222-316
Classification Level Classification E-value
Superfamily TAFH domain-like 6.93e-33
Family TAFH domain-like 0.00034
Further Details:      
 
Domain Number 2 Region: 641-690
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000000126
Family TBP-associated factors, TAFs 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075207   Gene: FBgn0010280   Transcript: FBtr0075450
Sequence length 851
Comment pep:known chromosome:BDGP5:3L:16106312:16114468:1 gene:FBgn0010280 transcript:FBtr0075450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTSQTAAGNRITFTSQPLPNGTISIAGNPGAVISTAQLPNTTTIKTIQAGIGGQHQGLQ
QVHHVQQQQQSQQQQQQQQQTQSAGQPLLNSMLPAGVVVGMRQQAPSQQQQKNVPTNPLS
RVVINSHMAGVRPQSPSSMTNTTATSNIIVNSVASSGYANSSQPPHLTQLNAQAPQLPQI
TQIQTIPAQQSQQQQVNNVSSAGGTATAVSSTTAATTTQQGNTKEKCRKFLANLIELSTR
EPKPVEKNVRTLIQELVNANVEPEEFCDRLERLLNASPQPCLIGFLKKSLPLLRQALYTK
ELVIEGIKPPPQHVLGLAGLSQQLPKIQAQIRPIGPSQTTTIGQTQVRMITPNALGTPRP
TIGHTTISKQPPNIRLPTAPRLVNTGGIRTQIPSLQVPGQANIVQIRGPQHAQLQRTGSV
QIRATTRPPNSVPTANKLTAVKVGQTQIKAITPSLHPPSLAAISGGPPPTPTLSVLSTLN
SASTTTLPIPSLPTVHLPPEALRAREQMQNSLNHNSNHFDAKLVEIKAPSLHPPHMERIN
ASLTPIGAKTMARPPPAINKAIGKKKRDAMEMDAKLNTSSGGAASAANSFFQQSSMSSMY
GDDDINDVAAMGGVNLAEESQRILGCTENIGTQIRSCKDEVFLNLPSLQARIRAITSEAG
LDEPSQDVAVLISHACQERLKNIVEKLAVIAEHRIDVIKLDPRYEPAKDVRGQIKFLEEL
DKAEQKRHEELEREMLLRAAKSRSRVEDPEQAKMKARAKEMQRAEMEELRQRDANLTALQ
AIGPRKKLKLDGETVSSGAGSSGGGVLSSSGSAPTTLRPRIKRVNLRDMLFYMEQEREFC
RSSMLFKTYLK
Download sequence
Identical sequences A4V201
FBpp0075207 FBpp0089259 NP_788511.1.81976 NP_996101.1.81976 FBpp0075207 FBpp0089259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]