SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0077614 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077614
Domain Number 1 Region: 590-798
Classification Level Classification E-value
Superfamily TPR-like 6.24e-34
Family Tetratricopeptide repeat (TPR) 0.00067
Further Details:      
 
Domain Number 2 Region: 753-932
Classification Level Classification E-value
Superfamily TPR-like 3.29e-23
Family Tetratricopeptide repeat (TPR) 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077614   Gene: FBgn0028481   Transcript: FBtr0077949
Sequence length 938
Comment pep:known chromosome:BDGP5:2L:922793:958098:1 gene:FBgn0028481 transcript:FBtr0077949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSLEPWLWGDSCSWLGMLAMLRLRLHKSNMDFTCLFCCSLAFVLYLNTLGAGFVYDDRR
AILANADVSGGTPWQRSFSNDFWGTPLTDSGSHGSWRPLCVLSFRLNYLIGGGFAPWGFH
LVNNLLHCVATALVVRVARTLLASVWAVLAAGALFAAHPIHTEAVAGVVGRADLAACVCY
LLTYLSYLRHMRWRESGDPRQWLALGATLILAAAGLLCKETAITALLVCALFDVMRGLSG
QVDKQRLRSVCIVLGALFCMAYCRLVIVPGPQTAFSSADNPIARTPSAWTRLLTFLYLPV
FNLRLLLQPNVLSFDWGMDALPRVTSLWDRRNAQSACFYSVLVGVAWGSCRQLLSGSKEV
THCGVSSTFPQYHIQKVASRKSRSKRKRLANNTKYQAFEAAYHQQQQEALPCRDCNNNNS
SGYVYEGSSPVAQAPAQAPHLVSSAFRGSRSSSSCSNSTNSSSSSSSSSSSSSSSSSSLS
GGFQCSSKDYALEGMSPANRHACVLIMSLSFLALPFLPASNLLFYVGFVVAERLLYLPSV
GFCLLVGYGVSKLMSCNQRTRNILLLSFSLLLAAMSLRTLRRNADWRDEESLYRSAIAIN
PPKALGNLGSVLSSQGRYEEAKQVLQEAIRFRPNMADVHFNLGILHQNQQVYPAAVECFQ
RAIKFRPNLAVAYLNLGISFIALGKRQQAIEILQAGSNLDGAAVRDRTAHDQARSSAYLQ
LGALYVEQGKLQRALAIYREALSSLPGLPQQREILYQRIGDVLGRLQQWDEAERHHRAAL
ELQPNQVAAHLSYGITLARNSSRASEAEMWFKRALKLAPEQASVYHHYAEFLSLQSRHHE
SAIYHRRAAELAPNDYTLVVAAATAMRLLDRKVDAEMWYRKAVALRPGDAHAHTNLGAIL
HLLGRTNHAAASYKAALRLQPGDAITLGNLAKLGVTNV
Download sequence
Identical sequences Q9V3X5
FBpp0077614 NP_608558.1.81976 FBpp0077614 FBpp0077614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]