SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080616 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080616
Domain Number 1 Region: 6-128
Classification Level Classification E-value
Superfamily NTF2-like 4.56e-38
Family NTF2-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080616   Gene: FBgn0032680   Transcript: FBtr0081063
Sequence length 130
Comment pep:known chromosome:BDGP5:2L:18454649:18455419:1 gene:FBgn0032680 transcript:FBtr0081063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLNLQYEDIGKEFVQQYYAIFDDPANRENVINFYNATDSFMTFEGNQIQGAPKILEKVQ
SLSFQKIARVITTVDSQPTSDGGVLIIVLGRLKCDDDPPHAFSQIFLLKPNGGSLFVAHD
IFRLNIHNSA
Download sequence
Identical sequences Q9VJ85
7298448___KOG2104 FBpp0080616 NP_609878.1.81976 FBpp0080616 7227.FBpp0080616 FBpp0080616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]