SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0083163 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083163
Domain Number 1 Region: 265-451
Classification Level Classification E-value
Superfamily NTF2-like 3.24e-61
Family TIM44-like 0.000000854
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083163   Gene: FBgn0038683   Transcript: FBtr0083749
Sequence length 459
Comment pep:known chromosome:BDGP5:3R:14980127:14985600:-1 gene:FBgn0038683 transcript:FBtr0083749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKATSCRPIPFINFRIVRYFYRPRRLNKYYDIYRIAALVRDRACLFTCQQASQNLQQQQP
RFYSAPGRRAGFFSQFFDNMKAEMDKNKEIKDNIRKFREEAQKLEESDALKSARQKFNIV
ESEAQKSSSMLKEQLGAIKERVGDVLEDASKSHLAKKVTEELSKKARGVSDTISDTSGKL
GQTSAFQAISNTTTTIKKEMDSASIENRVYRAPAKLRKRVQLVMSDSDRVVEPNTEATGM
ELHKDSKFYESWENFKNNNTYVNKVLDWKVKYDESENPVIRASRLLTDKVSDVMGGLFSK
TELSETMTELVKIDPSFDQKDFLRDCETDIIPNILESIVRGDLEILKDWCFESTFNIIAN
PIKEAKKAGVYLDSKILDIENIELAMGKVMEQGPVLIITFQAQQIMCVRDQKSQVVEGDP
EKVMRVHYVWVLCRDRNELNPKAAWRLMELSANSSEQFV
Download sequence
Identical sequences Q9VDZ7
FBpp0083163 FBpp0083163 FBpp0100000 NP_650786.2.81976 7227.FBpp0100000 FBpp0083163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]