SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0083164 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083164
Domain Number 1 Region: 234-420
Classification Level Classification E-value
Superfamily NTF2-like 2.76e-61
Family TIM44-like 0.000000854
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083164   Gene: FBgn0038683   Transcript: FBtr0083750
Sequence length 428
Comment pep:known chromosome:BDGP5:3R:14979819:14982739:-1 gene:FBgn0038683 transcript:FBtr0083750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRIAALVRDRACLFTCQQASQNLQQQQPRFYSAPGRRAGFFSQFFDNMKAEMDKNKEIK
DNIRKFREEAQKLEESDALKSARQKFNIVESEAQKSSSMLKEQLGAIKERVGDVLEDASK
SHLAKKVTEELSKKARGVSDTISDTSGKLGQTSAFQAISNTTTTIKKEMDSASIENRVYR
APAKLRKRVQLVMSDSDRVVEPNTEATGMELHKDSKFYESWENFKNNNTYVNKVLDWKVK
YDESENPVIRASRLLTDKVSDVMGGLFSKTELSETMTELVKIDPSFDQKDFLRDCETDII
PNILESIVRGDLEILKDWCFESTFNIIANPIKEAKKAGVYLDSKILDIENIELAMGKVME
QGPVLIITFQAQQIMCVRDQKSQVVEGDPEKVMRVHYVWVLCRDRNELNPKAAWRLMELS
ANSSEQFV
Download sequence
Identical sequences Q9VDZ8
FBpp0083164 NP_001027193.2.81976 NP_732403.1.81976 FBpp0083164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]