SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0083665 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083665
Domain Number 1 Region: 137-301
Classification Level Classification E-value
Superfamily NTF2-like 3.86e-31
Family TIM44-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083665   Gene: FBgn0263863   Transcript: FBtr0084272
Sequence length 361
Comment pep:known chromosome:BDGP5:3R:18444185:18445548:1 gene:FBgn0263863 transcript:FBtr0084272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKLASAKTCLKLLQVMPGVQQAALLPGGGLGVLASPLQNLIQMQQVRHRQTKHWKPEFK
RLRKLKFVKMDLPNLREKQEDITKEEMRSRMKERGVLPPRPWMERPFHISCTGGIFEAYV
PPEGDGKKSIISTSGAKQKLEFLEKKSKSLMAVRKIRSYDENFSSDDFGAEAQDIYIQAH
THMAAKDKYKIREFVSERCYPEMMHNVKDKTIRWKFLQSLEPPRVVHARVTEVITKENQF
AQVTVRFHSQQMLAIYDRFGRLMHGSEIITKDVLEYVVFEKHISNEYGKWRLHDKIIPDW
LPAKQPAPITYRLIEDAEEPPKELSAGDAEVKQVDSVGEQSKEQLPLATPVESHTKPSLA
I
Download sequence
Identical sequences Q9VCX3
FBpp0083665 7227.FBpp0083665 FBpp0083665 NP_651072.1.81976 FBpp0083665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]