SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0091058 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0091058
Domain Number 1 Region: 40-134
Classification Level Classification E-value
Superfamily Histone-fold 1.18e-89
Family Nucleosome core histones 0.00000808
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0091058   Gene: FBgn0053812   Transcript: FBtr0091816
Sequence length 136
Comment pep:known chromosome:BDGP5:2L:21440187:21440654:1 gene:FBgn0053812 transcript:FBtr0091816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
Download sequence
Identical sequences A0A016WNY5 A0A026VY52 A0A034WW13 A0A067QQU9 A0A076FEN6 A0A087QM07 A0A087YSG0 A0A091D7U9 A0A091EXQ2 A0A091HLP5 A0A091JBI0 A0A091RM08 A0A091VYD2 A0A093BKK8 A0A093IGK8 A0A096XIC3 A0A099ZGS6 A0A099ZYX9 A0A0A1X428 A0A0A9YRW6 A0A0B1RXW6 A0A0C2BQ16 A0A0D9SAA1 A0A0F7ZDP3 A0A0J7K8L1 A0A0K0DRK2 A0A0K2UL68 A0A0K8UA98 A0A0L7QNC5 A0A0L8GIF1 A0A0N0BG33 A0A0N0PFL9 A0A0N4XPK2 A0A0N5ACH0 A0A0N6W884 A0A0N6W885 A0A0N6W886 A0A0N6W887 A0A0N6W888 A0A0N6W889 A0A0N6W890 A0A0N6W891 A0A0N6W892 A0A0N6W893 A0A0N6W894 A0A0N6W895 A0A0N6W896 A0A0N6W897 A0A0N6W898 A0A0N6W899 A0A0N6W8A0 A0A0N6W8A1 A0A0N6W8A2 A0A0N7AAA7 A0A0N7AAB0 A0A0N7AAB4 A0A0N7AAB5 A0A0N7AAB6 A0A0N7AAC0 A0A0N7AAC3 A0A0N7AAC8 A0A0N7AAC9 A0A0N7AAD3 A0A0N7AAD6 A0A0N7AAD7 A0A0N7AAE3 A0A0N7AAE9 A0A0N7AAF0 A0A0N7AAF2 A0A0N7AAF3 A0A0N7AAF4 A0A0N7AAF6 A0A0N7AAF9 A0A0N7AAG0 A0A0N7AAG2 A0A0N7AAG3 A0A0N7AAG5 A0A0N7AAG6 A0A0N7AAG7 A0A0N7AAH0 A0A0N7AAH2 A0A0N7AAH4 A0A0N7AAH5 A0A0N7AAH8 A0A0N7AAH9 A0A0N7AAI1 A0A0N7AAI2 A0A0N7AAI4 A0A0N7AAI7 A0A0N7AAI8 A0A0N7AAI9 A0A0N7AAJ1 A0A0N7AAJ3 A0A0N7AAJ4 A0A0N7AAJ5 A0A0N7AAJ6 A0A0N7AAK1 A0A0N7AAK2 A0A0N7AAK3 A0A0N7AAK4 A0A0N7AAK7 A0A0N7AAK8 A0A0N7AAK9 A0A0N7AAL1 A0A0N7AAL4 A0A0N7AAL5 A0A0N7AAL6 A0A0N7AAL7 A0A0N7AAL8 A0A0N7AAM1 A0A0N7AAM2 A0A0N7AAM4 A0A0N7AAM6 A0A0N7AAM8 A0A0N7AAM9 A0A0N7AAN0 A0A0N7AAN1 A0A0N7AAN4 A0A0N7AAN6 A0A0N7AAN7 A0A0N7AAN8 A0A0N7AAN9 A0A0N7AAP1 A0A0N7AAP3 A0A0N7AAP4 A0A0N7AAP5 A0A0N7AAP6 A0A0N7AAP8 A0A0N7AAP9 A0A0N7AAQ0 A0A0N7AAQ2 A0A0N7AAQ3 A0A0N7AAQ5 A0A0N7AAQ7 A0A0N7AAQ8 A0A0N7AAR0 A0A0N7AAR2 A0A0N7AAR3 A0A0N7AAR4 A0A0N7AAR7 A0A0N7AAR8 A0A0N7AAS0 A0A0N7AAS1 A0A0N7AAS4 A0A0N7AAS6 A0A0N7AAS7 A0A0N7AAS9 A0A0N7AAT0 A0A0N7AAT2 A0A0N7AAT5 A0A0N7AAT6 A0A0N7AAT8 A0A0N7AAU1 A0A0N7AAU3 A0A0N7AAU5 A0A0N7AAU7 A0A0N7AAV1 A0A0N7AAV3 A0A0N7AAV8 A0A0N7AAW0 A0A0N7AAW3 A0A0N7AAW7 A0A0N7AAX2 A0A0N7AAX3 A0A0N7AAX9 A0A0N7AAY0 A0A0N7AAY3 A0A0N7AAY8 A0A0N7AAY9 A0A0N7AAZ6 A0A0N7AAZ7 A0A0N7AB02 A0A0N7AB04 A0A0N7AB11 A0A0N7AB17 A0A0N7AB21 A0A0N7AB27 A0A0N7ACI3 A0A0N7ACJ1 A0A0N7ACJ4 A0A0N7ACK0 A0A0N7ACK7 A0A0N7ACL1 A0A0N7ACL6 A0A0N7ACM4 A0A0N7ACN0 A0A0N7ACN6 A0A0N7ACN9 A0A0N7ACP6 A0A0N7ACQ0 A0A0N7ACQ4 A0A0N7ACR0 A0A0N7ACR3 A0A0N7ACR4 A0A0N7ACR7 A0A0N7ACR9 A0A0N7ACS1 A0A0N7ACS2 A0A0N7ACS4 A0A0N7ACS8 A0A0N7ACT0 A0A0N7ACT1 A0A0N7ACT5 A0A0N7ACT8 A0A0N7ACU0 A0A0N7ACU9 A0A0N7ACV4 A0A0N7ACW1 A0A0N7ACW5 A0A0N7ACX1 A0A0N7ACX9 A0A0N7ACY7 A0A0N7ACZ1 A0A0N7ACZ4 A0A0N7AD00 A0A0N7AD04 A0A0N7AD08 A0A0N7AD14 A0A0N7AD18 A0A0P4WA66 A0A0P4YJG6 A0A0Q3X2N7 A0A0R3PLN2 A0A0S7H284 A0A132ABT1 A0A147AYR3 A0A151I9Q0 A0A151LYX7 A0A151XES9 A0A154PLX2 A0A182FDH4 A0A182G755 A0A182HQS9 A0A182K6G5 A0A182KYS2 A0A182MEN2 A0A182N1S5 A0A182PW00 A0A182RUT9 A0A182T3D1 A0A182TTM1 A0A182UNC7 A0A182W171 A0A182XUN6 A0A182YQY5 A0A183G9P9 A0A183IFK6 A0A194Q709 A0A195B3B9 A0A195D9Z7 A0A195F6K5 A0A1A6H6Y7 A0A1A7X5B4 A0A1A9UHF1 A0A1A9WWP2 A0A1A9XPL8 A0A1A9Z4G5 A0A1B0BDU1 A0A1B8XZW2 A0A1D2M400 A0A1J1J3T1 A0A1L8G0S1 A0A1S3A9U3 A0A1S3GD22 A0A1S3K178 A0A1S4ENC8 A0A1U7RL46 A0A1U8BEY3 A0A1V4JAD7 A0A1W2WCU7 A0A1W4ZDM7 A0A1W7RGT6 A0A1X7T1W6 A0A1Y1S4K8 A0A1Z5L7F9 A0A212FDS3 A0A221C7A8 A0A221C7C1 A0A221C7D0 A0A221C7D4 A0A221C7D5 A0A221C7D6 A0A221C7D7 A0A221C7D8 A0A221C7D9 A0A221C7E0 A0A221C7E1 A0A221C7E2 A0A221C7E3 A0A221C7E4 A0A221C7E5 A0A221C7E6 A0A221C7E8 A0A221C7F1 A0A221C7F3 A0A221C7F4 A0A222NQ96 A0A222NQA1 A0A222NQA6 A0A222NQB3 A0A222NQB4 A0A222NQB5 A0A222NQB7 A0A222NQB8 A0A222NQB9 A0A222NQC0 A0A222NQC3 A0A222NQC4 A0A222NQC5 A0A222NQC8 A0A222NQC9 A0A222NQD1 A0A222NQD2 A0A222NQD3 A0A222NQD4 A0A222NQD8 A0A222NQD9 A0A222NQE2 A0A222NQE3 A0A222NQE4 A0A222NQE5 A0A222NQE6 A0A222NQE7 A0A222NQE9 A0A222NQF0 A0A224Z0L1 A0A226E6A7 A0A226MDQ5 A0A226P6Z2 A0A232F710 A0A232LMS4 A0A286XJW0 A0A286ZJQ0 A0A293LL03 A0A2A3ENK3 A0A2D0QHE9 A0A2D9B6T5 A0A2I3HCD1 A0A2I3LJ54 A0A2J7R6W1 A0A2K5E1H1 A0A2K5H7S6 A0A2K5KXP4 A0A2K5PEV8 A0A2K5XGT4 A0A2K6AVU8 A0A2K6EPW6 A0A2K6JWA0 A0A2K6QKI2 A0A2K6S6J8 A2CI33 A7RJL1 A8WB75 B0WFI0 B3FEA6 B3FEB1 B3FEB6 B3MUM5 B3NLS0 B3RWE2 B4G2R0 B4JZ48 B4K7B0 B4LVM6 B4MHK1 B9EI85 C1BR92 C1C1U0 C3Z764 C4WWS4 D2I755 D2N2P9 D3TKL3 D3ZJ08 D7EKP3 E0VXR5 E2A0J3 E2C5E5 E3WLC5 E4XR78 E9FUS8 F4WQG5 F6QTF3 F7B0Z5 F7C7V4 F7C964 F7IE00 G1KKF9 G1N7D3 G1TKV4 G3HDS5 G3MMX6 G3RBP3 G3UBN8 G5BQE3 G8F5U3 H0XHJ2 H0ZG75 H2L744 H2PUI4 H2R5Q1 H2RVI8 H2Z6S2 H9IB76 H9K244 I3N8V4 J3L8G4 J9P7X1 K1Q9L4 K7F0X9 K7IT53 L5K2T3 L7LVH9 M3X7H5 M4AYZ1 M7BII1 M7ZPB4 P02299 P84227 P84228 P84229 P84230 P84231 P84232 P84233 P84234 P84235 P84236 P84237 P84238 P84239 Q16N56 Q1HQ24 Q28D37 Q4QRF4 Q4SKP1 Q6LBE8 Q6WV78 Q6WV87 Q6YNI3 Q71DI3 Q76MP7 Q76MP8 Q76MP9 Q76MQ0 Q76MQ1 Q76MZ6 Q76MZ7 Q76MZ8 Q76MZ9 Q76N00 Q76N01 Q7JNA0 Q7K8B9 Q7KFE7 Q7PD39 R0LY36 R4FM54 R7TNC5 R7VXA0 S4PSP4 S4S357 S9XBX2 T1E5I5 T1G8J4 T1GGX5 T1IH13 T1K8J3 U3KKS0 V3ZDD5 V5GMC0 V8NHF7 W5PTZ9 W8C5G0
AGAP003910-PA|hypothetical AGAP005024-PA|hypothetical AGAP005025-PA|hypothetical AGAP012559-PA|hypothetical AGAP012572-PA|hypothetical AGAP012573-PA|hypothetical ENSEEUP00000005554 ENSRNOP00000040167 ENSRNOP00000044600 ENSRNOP00000044831 ENSGALP00000031319 ENSGALP00000037294 ENSGALP00000037310 ENSOANP00000000329 ENSOANP00000005893 tetur05g07250 tetur05g07300 tetur07g01530 ENSVPAP00000000469 FBpp0181908 FBpp0183808 FBpp0186480 FBpp0188058 FBpp0188062 FBpp0188065 FBpp0188068 ENSOCUP00000016501 ENSOCUP00000017598 ENSORLP00000001653 ENSTNIP00000000561 ENSTNIP00000005044 ENSTNIP00000010417 ENSTNIP00000011592 ENSTNIP00000011621 jgi|Triad1|24875|e_gw1.5.683.1 MESCA002656-PA MESCA003328-PA CPIJ006050|histone CPIJ012379|histone CPIJ012384|histone CPIJ012389|histone CPIJ012394|histone CPIJ012402|histone CPIJ012411|histone CPIJ012418|histone CPIJ012424|histone CPIJ014769|histone CPIJ015006|histone ENSGGOP00000012904 ENSGGOP00000020787 ENSGGOP00000025430 1eqz_C 1eqz_G 1hq3_C 1hq3_G 1tzy_C 1tzy_G 2aro_C 2aro_G 2f8n_A 2f8n_E 2hio_C 4kgc_A 4kgc_E 4ld9_A 4ld9_E 4uuz_A 5kgf_A 5kgf_E 5x0x_A 5x0x_E gi|183076548|ref|NP_001116847.1| gi|31742503|ref|NP_066403.2| gi|53793688|ref|NP_001005464.1| ENSGMOP00000021196 ENSGMOP00000021201 ENSGMOP00000021230 ENSGMOP00000021353 ENSGMOP00000021371 ENSGMOP00000021503 ENSGMOP00000021687 ENSGMOP00000021691 ENSGMOP00000021920 ENSGMOP00000021922 FBpp0129546 FBpp0129550 FBpp0129553 FBpp0129556 FBpp0131121 FBpp0131125 FBpp0131501 FBpp0131536 FBpp0131541 FBpp0131554 FBpp0131560 FBpp0131566 FBpp0131570 FBpp0131608 FBpp0134903 FBpp0134915 FBpp0136789 FBpp0138337 FBpp0138352 FBpp0138362 FBpp0138376 FBpp0138396 FBpp0139853 FBpp0139856 FBpp0139859 FBpp0139862 FBpp0139866 FBpp0139869 FBpp0139872 FBpp0139876 FBpp0139879 FBpp0139880 ENSXMAP00000019686 ENSTTRP00000004785 ENSTTRP00000004825 ADAR005976-PA ADAR006175-PA FBpp0085250 FBpp0091051 FBpp0091053 FBpp0091056 FBpp0091058 FBpp0091061 FBpp0091064 FBpp0091067 FBpp0091070 FBpp0091073 FBpp0091076 FBpp0091079 FBpp0091082 FBpp0091085 FBpp0091088 FBpp0091091 FBpp0091094 FBpp0091097 FBpp0091100 FBpp0091103 FBpp0091106 FBpp0091109 FBpp0091112 ENSSTOP00000015105 ENSSTOP00000017184 ENSSTOP00000018243 ENSSTOP00000020800 ENSSTOP00000015105 ENSSTOP00000017184 ENSSTOP00000018243 ENSSTOP00000020800 ENSETEP00000009942 DS10_00008899 ENSPSIP00000000616 ENSPSIP00000001384 ENSPSIP00000001666 ENSPSIP00000001689 ENSCAFP00000041760 vb|PHUM503970-PA|EEB18171.1|histone vb|PHUM504060-PA|EEB18180.1|histone Hsal_03874--XP_001120304.1_APIME Hsal_03976--XP_001120304.1_APIME ENSMUSP00000074994 ENSMUSP00000089295 ENSMUSP00000089346 ENSMUSP00000096442 ENSMUSP00000100737 ENSMUSP00000100739 ENSMUSP00000134751 ENSMUSP00000135215 ENSMEUP00000000617 ENSMEUP00000000820 ENSMEUP00000005435 ENSMEUP00000008882 ENSCSAVP00000002687 ENSCSAVP00000013284 ENSDARP00000084277 ENSDARP00000101193 ENSDARP00000112824 ENSDARP00000113307 ENSDARP00000127943 ENSDARP00000128757 ENSDARP00000129330 ENSTGUP00000009582 ENSTGUP00000009587 ENSTGUP00000009589 ENSTGUP00000009609 ENSTGUP00000009656 ENSTGUP00000009659 ENSTGUP00000015076 1tzyC ENSMUSP00000074994 ENSMUSP00000089295 ENSMUSP00000089346 ENSMUSP00000096442 ENSMUSP00000100737 ENSMUSP00000100739 ENSPPYP00000001074 ENSPPYP00000022371 ENSMICP00000000254 ENSMICP00000000256 ENSMICP00000000259 RPRC005821-PA RPRC009024-PA RPRC014641-PA RPRC014755-PA FBpp0160475 FBpp0161930 FBpp0166110 FBpp0166468 FBpp0166470 FBpp0166472 FBpp0171093 FBpp0172655 FBpp0172657 FBpp0172659 FBpp0172663 FBpp0174074 ENSTTRP00000004785 ENSTTRP00000004825 ENSPTRP00000002098 ENSPTRP00000048353 ENSMUSP00000074994 ENSMUSP00000089295 ENSMUSP00000089346 ENSMUSP00000096442 ENSMUSP00000100737 ENSMUSP00000100739 ENSMUSP00000135215 ENSP00000333277 ENSP00000358154 ENSP00000385479 ENSP00000463420 ENSP00000463798 ENSP00000463995 ENSTNIP00000000561 ENSTNIP00000005044 ENSTNIP00000010417 ENSTNIP00000011592 ENSTNIP00000011621 jgi|Helro1|79198 jgi|Helro1|92562 jgi|Helro1|92640 jgi|Helro1|92700 DPGLEAN19632-PA NP_001005464.1.87134 NP_001005464.1.92137 NP_001016636.1.99540 NP_001027285.1.81976 NP_001027289.1.81976 NP_001027294.1.81976 NP_001027298.1.81976 NP_001027303.1.81976 NP_001027308.1.81976 NP_001027313.1.81976 NP_001027318.1.81976 NP_001027323.1.81976 NP_001027328.1.81976 NP_001027333.1.81976 NP_001027338.1.81976 NP_001027343.1.81976 NP_001027348.1.81976 NP_001027353.1.81976 NP_001027358.1.81976 NP_001027363.1.81976 NP_001027368.1.81976 NP_001027373.1.81976 NP_001027378.1.81976 NP_001027383.1.81976 NP_001027387.1.81976 NP_001040399.1.14763 NP_001091428.1.7800 NP_001093643.1.45394 NP_001101168.1.100692 NP_001101168.1.4139 NP_001116847.1.87134 NP_001116847.1.92137 NP_001160041.1.59421 NP_001160041.1.76553 NP_001231571.1.46622 NP_001268409.1.86415 NP_001268438.1.86415 NP_038576.1.92730 NP_066403.2.87134 NP_066403.2.92137 NP_473386.1.92730 NP_724345.1.81976 NP_783584.1.92730 NP_835510.1.92730 NP_835511.1.92730 NP_835512.1.92730 NP_835587.1.92730 NP_835734.2.92730 WP_047149380.1.41368 XP_001120132.1.77095 XP_001232833.1.86415 XP_001233028.1.86415 XP_001364839.1.35504 XP_001500143.1.31192 XP_001506572.1.37387 XP_001508660.2.37387 XP_001509264.1.37387 XP_001513360.1.37387 XP_001514437.1.37387 XP_001599179.2.61660 XP_001599419.1.61660 XP_001603659.1.61660 XP_001607330.1.61660 XP_001607935.1.61660 XP_001608284.1.61660 XP_001618211.1.94760 XP_001618631.1.94760 XP_001618759.1.94760 XP_001618804.1.94760 XP_001619112.1.94760 XP_001619731.1.94760 XP_001619868.1.94760 XP_001622884.1.94760 XP_001622885.1.94760 XP_001628765.1.94760 XP_001628767.1.94760 XP_001632610.1.94760 XP_001633293.1.94760 XP_001638461.1.94760 XP_001638527.1.94760 XP_001639376.1.94760 XP_001640345.1.94760 XP_001640368.1.94760 XP_001640467.1.94760 XP_001640469.1.94760 XP_001656985.1.48696 XP_001656989.1.48696 XP_001657156.1.48696 XP_001657265.1.48696 XP_001657268.1.48696 XP_001657279.1.48696 XP_001662236.1.48696 XP_001847464.1.94360 XP_001862655.1.94360 XP_001862660.1.94360 XP_001862665.1.94360 XP_001862670.1.94360 XP_001862678.1.94360 XP_001862687.1.94360 XP_001862694.1.94360 XP_001862700.1.94360 XP_001865169.1.94360 XP_001865497.1.94360 XP_001950199.1.67334 XP_001952101.2.67334 XP_001964821.1.52611 XP_001967678.1.52611 XP_001967729.1.52611 XP_001967770.1.52611 XP_001967787.1.52611 XP_001967819.1.52611 XP_001967879.1.52611 XP_001967892.1.52611 XP_001982917.1.56816 XP_001996376.1.65300 XP_001996381.1.65300 XP_001996386.1.65300 XP_001996391.1.65300 XP_001996395.1.65300 XP_001996399.1.65300 XP_001996404.1.65300 XP_001996409.1.65300 XP_001996414.1.65300 XP_001996419.1.65300 XP_001996422.1.65300 XP_001996426.1.65300 XP_001996431.1.65300 XP_001996435.1.65300 XP_001996798.1.65300 XP_001996804.1.65300 XP_001996813.1.65300 XP_001996816.1.65300 XP_001997180.1.65300 XP_001997205.1.65300 XP_001997209.1.65300 XP_001997410.1.65300 XP_001997414.1.65300 XP_001997685.1.65300 XP_001997736.1.65300 XP_001997787.1.65300 XP_001997839.1.65300 XP_001997901.1.65300 XP_001997983.1.65300 XP_001997993.1.65300 XP_001998117.1.65300 XP_001998773.1.58863 XP_001998779.1.58863 XP_002002205.1.58863 XP_002002990.1.58863 XP_002012537.1.58863 XP_002012558.1.58863 XP_002012640.1.58863 XP_002012683.1.58863 XP_002013119.1.64850 XP_002013125.1.64850 XP_002013130.1.64850 XP_002013135.1.64850 XP_002029055.1.64850 XP_002029392.1.64850 XP_002029490.1.64850 XP_002044743.1.34323 XP_002044746.1.34323 XP_002044756.1.34323 XP_002044761.1.34323 XP_002044765.1.34323 XP_002044770.1.34323 XP_002044955.1.34323 XP_002044960.1.34323 XP_002045027.1.34323 XP_002045032.1.34323 XP_002045046.1.34323 XP_002045054.1.34323 XP_002045058.1.34323 XP_002045092.1.34323 XP_002045256.1.34323 XP_002045356.1.34323 XP_002045363.1.34323 XP_002045368.1.34323 XP_002045378.1.34323 XP_002045385.1.34323 XP_002045390.1.34323 XP_002045409.1.34323 XP_002045494.1.34323 XP_002045512.1.34323 XP_002045517.1.34323 XP_002045522.1.34323 XP_002045595.1.34323 XP_002045615.1.34323 XP_002045619.1.34323 XP_002045639.1.34323 XP_002045689.1.34323 XP_002045695.1.34323 XP_002045699.1.34323 XP_002045729.1.34323 XP_002045779.1.34323 XP_002045782.1.34323 XP_002045809.1.34323 XP_002045812.1.34323 XP_002045829.1.34323 XP_002045835.1.34323 XP_002045863.1.34323 XP_002045876.1.34323 XP_002045918.1.34323 XP_002045937.1.34323 XP_002045949.1.34323 XP_002045972.1.34323 XP_002045990.1.34323 XP_002046018.1.34323 XP_002046072.1.34323 XP_002052270.1.90633 XP_002053110.1.90633 XP_002060410.1.90633 XP_002060451.1.90633 XP_002060477.1.90633 XP_002060488.1.90633 XP_002060513.1.90633 XP_002060514.1.90633 XP_002060537.1.90633 XP_002060571.1.90633 XP_002060604.1.14588 XP_002069215.1.14588 XP_002112565.1.101920 XP_002128382.1.78797 XP_002129014.1.78797 XP_002193332.1.42559 XP_002430909.1.24195 XP_002430918.1.24195 XP_002586356.1.56174 XP_002586365.1.56174 XP_002595648.1.56174 XP_002595666.1.56174 XP_002595678.1.56174 XP_002595709.1.56174 XP_002595710.1.56174 XP_002595719.1.56174 XP_002595735.1.56174 XP_002666951.1.45394 XP_002731238.1.86028 XP_002732482.1.86028 XP_002732963.1.86028 XP_002733415.1.86028 XP_002736572.1.86028 XP_002737855.1.86028 XP_002738083.1.86028 XP_002738089.1.86028 XP_002738203.1.86028 XP_002740695.1.86028 XP_002741072.1.86028 XP_002741741.1.86028 XP_002741826.1.86028 XP_002834873.2.23681 XP_002942339.1.99540 XP_002943524.1.99540 XP_002944659.1.99540 XP_002944964.1.99540 XP_002945274.2.99540 XP_003221089.1.98722 XP_003224524.1.98722 XP_003227268.1.98722 XP_003248421.1.67334 XP_003251619.1.77095 XP_003391250.1.10788 XP_003392965.1.43243 XP_003392969.1.43243 XP_003409561.1.64505 XP_003409565.1.64505 XP_003424487.1.61660 XP_003425535.1.61660 XP_003451202.1.78416 XP_003451214.1.78416 XP_003459141.1.78416 XP_003459144.1.78416 XP_003459573.1.78416 XP_003460246.1.78416 XP_003463260.1.53824 XP_003478903.1.53824 XP_003489849.1.29386 XP_003489853.1.29386 XP_003492166.1.29386 XP_003502222.1.69978 XP_003697960.1.59471 XP_003697994.1.59471 XP_003697995.1.59471 XP_003707914.1.71094 XP_003768756.1.9362 XP_003800470.1.62490 XP_003803809.1.62490 XP_003803812.1.62490 XP_003808846.1.60992 XP_003942033.1.74449 XP_003967841.1.43653 XP_003967881.1.43653 XP_003976988.1.43653 XP_003977328.2.43653 XP_003979103.1.43653 XP_003979222.1.43653 XP_003979633.1.43653 XP_003979798.1.43653 XP_003979802.1.43653 XP_004076082.1.28442 XP_004175929.1.42559 XP_004285166.1.21590 XP_004285171.1.21590 XP_004389662.1.4749 XP_004404232.1.74151 XP_004461699.1.11602 XP_004564943.1.88231 XP_004576159.1.88231 XP_004588885.1.84141 XP_004588887.1.84141 XP_004588890.1.84141 XP_004628473.1.9945 XP_004628479.1.9945 XP_004632476.1.9945 XP_004640161.1.9945 XP_004670895.1.11716 XP_004716622.1.18182 XP_004782631.1.14098 XP_004853987.1.39548 XP_004913911.1.99540 XP_004915673.1.99540 XP_004917039.1.99540 XP_004919171.1.99540 XP_004919181.1.99540 XP_004934098.1.14763 XP_004934117.1.14763 XP_004934133.1.14763 XP_004934172.1.14763 XP_004934194.1.14763 XP_005007814.1.53824 XP_005007816.1.53824 XP_005012229.1.99704 XP_005012232.1.99704 XP_005039661.1.66865 XP_005039662.1.66865 XP_005039665.1.66865 XP_005039667.1.66865 XP_005039673.1.66865 XP_005062980.1.66865 XP_005110442.1.21191 XP_005150329.1.78019 XP_005308989.1.60341 XP_005331191.1.77405 XP_005331196.1.77405 XP_005399005.1.28644 XP_005403365.1.28644 XP_005441372.1.10750 XP_005455907.1.78416 XP_005459205.1.78416 XP_005462224.1.78416 XP_005480799.1.73095 XP_005515111.1.63277 XP_005515115.1.63277 XP_005515125.1.63277 XP_005527767.1.90289 XP_005734222.1.53837 XP_005750283.1.53837 XP_005751312.1.53837 XP_005755872.1.53837 XP_005811245.1.87360 XP_005815223.1.87360 XP_005817667.1.87360 XP_005817698.1.87360 XP_005949985.1.24487 XP_005959640.1.78601 XP_006014939.1.24877 XP_006049258.1.26621 XP_006049260.1.26621 XP_006095231.1.53796 XP_006125973.1.96668 XP_006186635.1.101512 XP_006216974.1.17985 XP_006219813.1.17985 XP_006222460.2.4139 XP_006254041.2.100692 XP_006570899.1.77095 XP_006618073.1.66377 XP_006621110.1.66377 XP_006621124.1.66377 XP_006665102.1.55871 XP_006750234.1.47382 XP_006750238.1.47382 XP_006781035.1.46954 XP_006781085.1.46954 XP_006781097.1.46954 XP_006808339.1.46954 XP_006820299.1.86028 XP_006861408.1.41390 XP_006861409.1.41390 XP_006902296.1.29581 XP_006902299.1.29581 XP_006993210.1.50099 XP_007064098.1.26238 XP_007064099.1.26238 XP_007070175.1.26238 XP_007178006.1.59432 XP_007427782.1.37977 XP_007445389.1.37977 XP_007483142.1.35504 XP_007531637.1.11023 XP_007534740.1.11023 XP_007555955.1.10163 XP_007561740.1.10163 XP_007561744.1.10163 XP_007574072.1.10163 XP_007634641.1.28591 XP_007634657.1.28591 XP_007640990.1.69978 XP_007883034.1.63211 XP_007949167.1.48129 XP_007949170.1.48129 XP_008018003.1.81039 XP_008115366.1.98722 XP_008172411.1.60341 XP_008190047.1.67334 XP_008190048.1.67334 XP_008278491.1.38333 XP_008292395.1.38333 XP_008294073.1.38333 XP_008308957.1.100486 XP_008412290.1.1237 XP_008477668.1.36046 XP_008479071.1.36046 XP_008482959.1.36046 XP_008482968.1.36046 XP_008484708.1.36046 XP_008491721.1.100939 XP_008495139.1.100939 XP_008545619.1.5247 XP_008548645.1.5247 XP_008550905.1.5247 XP_008552420.1.5247 XP_008556698.1.5247 XP_008560152.1.5247 XP_008560312.1.5247 XP_008560345.1.5247 XP_008583791.1.73410 XP_008634730.1.15636 XP_008693968.1.72690 XP_008769899.1.100692 XP_008772193.1.4139 XP_008824858.1.79516 XP_008830090.1.79516 XP_008830109.1.79516 XP_008841937.1.79516 XP_008958392.1.60992 XP_009017733.1.102002 XP_009018939.1.102002 XP_009021573.1.102002 XP_009022419.1.102002 XP_009052125.1.39240 XP_009054644.1.39240 XP_009056376.1.39240 XP_009059094.1.39240 XP_009059299.1.39240 XP_009065730.1.39240 XP_009067270.1.39240 XP_009084853.1.15306 XP_009243259.1.23681 XP_009288329.1.47732 XP_009288342.1.47732 XP_009296462.1.45394 XP_009428350.1.37143 XP_009428464.1.37143 XP_009638415.1.23211 XP_009675852.1.43253 XP_009896818.1.92783 XP_009896826.1.92783 XP_009896827.1.92783 XP_009896828.1.92783 XP_010186631.1.17318 XP_010211924.1.20684 XP_010211925.1.20684 XP_010216917.1.20684 XP_010223167.1.20684 XP_010223168.1.20684 XP_010353240.1.97406 XP_010371591.1.97406 XP_010374671.1.97406 XP_010409007.1.2935 XP_010409008.1.2935 XP_010409015.1.2935 XP_010409018.1.2935 XP_010567513.1.12557 XP_010567521.1.12557 XP_010567525.1.12557 XP_010621019.1.5607 XP_010621295.1.5607 XP_010634567.1.5607 XP_010708157.2.16129 XP_010725973.1.16129 XP_010746616.1.61708 XP_010754581.2.61708 XP_010754652.1.61708 XP_010837041.1.44457 XP_010837046.1.44457 XP_010956830.1.22495 XP_011057615.1.86870 XP_011062466.1.86870 XP_011151028.1.56509 XP_011165753.1.47049 XP_011166327.1.47049 XP_011264340.1.72520 XP_011265838.1.72520 XP_011268848.1.72520 XP_011311110.1.61867 XP_011312022.1.61867 XP_011313108.1.61867 XP_011350491.1.87679 XP_011416643.1.10878 XP_011472070.1.28442 XP_011473870.1.28442 XP_011478933.1.28442 XP_011491737.1.28442 XP_011495696.1.84716 XP_011496729.1.84716 XP_011497548.1.84716 XP_011501815.1.84716 XP_011501822.1.84716 XP_011557834.1.9062 XP_011557839.1.9062 XP_011563332.1.9062 XP_011598885.1.59079 XP_011598889.1.59079 XP_011611356.1.43653 XP_011619654.1.43653 XP_011620003.1.43653 XP_011620058.1.43653 XP_011632089.1.19355 XP_011632651.1.19355 XP_011633176.1.19355 XP_011640858.1.19355 XP_011693179.1.89273 XP_011696996.1.89273 XP_011735021.1.29376 XP_011849825.1.47321 XP_011849826.1.47321 XP_011860351.1.68811 XP_011867889.1.68811 XP_011874826.1.68811 XP_011930869.1.92194 XP_011930872.1.92194 XP_012016750.1.54773 XP_012055629.1.45171 XP_012055713.1.45171 XP_012059087.1.45171 XP_012227611.1.42766 XP_012228217.1.42766 XP_012229246.1.42766 XP_012241565.1.29386 XP_012257767.1.80111 XP_012265193.1.80111 XP_012265194.1.80111 XP_012265357.1.80111 XP_012265468.1.80111 XP_012281222.1.87881 XP_012284395.1.87881 XP_012286988.1.87881 XP_012297531.1.9421 XP_012311722.1.9421 XP_012311725.1.9421 XP_012372132.1.9945 XP_012404126.1.9362 XP_012405124.1.9362 XP_012424541.1.42559 XP_012424543.1.42559 XP_012424547.1.42559 XP_012514226.1.63892 XP_012524290.1.53737 XP_012534044.1.53737 XP_012552361.1.14763 XP_012667251.1.62490 XP_012669844.1.3086 XP_012669862.1.3086 XP_012672878.1.3086 XP_012673260.1.3086 XP_012673329.1.3086 XP_012676395.1.3086 XP_012677950.1.3086 XP_012677951.1.3086 XP_012678826.1.3086 XP_012682540.1.3086 XP_012684499.1.3086 XP_012687359.1.3086 XP_012694617.1.3086 XP_012694742.1.3086 XP_012713852.1.37407 XP_012724178.1.37407 XP_012732137.1.37407 XP_012776143.1.88231 XP_012807212.1.11716 XP_012808793.1.99540 XP_012809130.1.99540 XP_012809131.1.99540 XP_012809329.1.99540 XP_012817495.1.99540 XP_012817500.1.99540 XP_012817501.1.99540 XP_012870527.1.60039 XP_012886721.1.60039 XP_012890670.1.60039 XP_012892926.1.60039 XP_012928648.1.39548 XP_012948124.1.99704 XP_012966031.1.91757 XP_013006889.1.53824 XP_013052031.1.65836 XP_013120692.1.78416 XP_013129004.1.78416 XP_013138668.1.63905 XP_013154560.1.75256 XP_013196489.1.6669 XP_013205288.1.66349 XP_013359243.1.28644 XP_013359244.1.28644 XP_013359245.1.28644 XP_013391348.1.76062 XP_013416042.1.76062 XP_013416055.1.76062 XP_013416287.1.76062 XP_013422139.1.76062 XP_013802639.1.3284 XP_013802640.1.3284 XP_013802641.1.3284 XP_013802642.1.3284 XP_013802643.1.3284 XP_013907718.1.67126 XP_013914336.1.67126 XP_013914337.1.67126 XP_013915318.1.67126 XP_013976105.1.84170 XP_014104305.1.90289 XP_014104307.1.90289 XP_014112031.1.90289 XP_014193840.1.24487 XP_014204207.1.61449 XP_014206346.1.61449 XP_014206350.1.61449 XP_014206369.1.61449 XP_014206370.1.61449 XP_014207764.1.61449 XP_014214570.1.61449 XP_014219704.1.61449 XP_014219706.1.61449 XP_014219715.1.61449 XP_014224006.1.28516 XP_014226066.1.28516 XP_014236534.1.28516 XP_014236557.1.28516 XP_014236558.1.28516 XP_014236664.1.28516 XP_014237176.1.28516 XP_014237177.1.28516 XP_014237178.1.28516 XP_014258938.1.82534 XP_014263258.1.88231 XP_014263887.1.88231 XP_014264202.1.88231 XP_014265594.1.88231 XP_014295224.1.5247 XP_014295225.1.5247 XP_014299678.1.5247 XP_014300691.1.5247 XP_014360556.1.63768 XP_014361433.1.63768 XP_014375698.1.24877 XP_014423824.1.101512 XP_014460645.1.47583 XP_014481139.1.44477 XP_014481208.1.44477 XP_014603633.1.41157 XP_014603634.1.41157 XP_014662650.1.89999 XP_014665974.1.89999 XP_014677959.1.89999 XP_014678482.1.89999 XP_014720929.1.49734 XP_014720930.1.49734 XP_014720931.1.49734 XP_014720932.1.49734 XP_014720933.1.49734 XP_014720935.1.49734 XP_014723587.1.49734 XP_014747916.1.99236 XP_014749759.1.99236 XP_014759036.1.52611 XP_014775989.1.24776 XP_014780709.1.24776 XP_014782547.1.24776 XP_014784549.1.24776 XP_014818875.1.91963 XP_014818876.1.91963 XP_014818877.1.91963 XP_014818878.1.91963 XP_014818880.1.91963 XP_014818898.1.91963 XP_014827632.1.96476 XP_014832957.1.96476 XP_014833621.1.96476 XP_014835035.1.96476 XP_014835206.1.96476 XP_014841698.1.96476 XP_014854839.1.96476 XP_014875181.1.100837 XP_014884697.1.100837 XP_014893548.1.100837 XP_014897150.1.100837 XP_014903953.1.100837 XP_014905947.1.100837 XP_014935752.1.86478 XP_015108283.1.60272 XP_015108290.1.60272 XP_015108320.1.60272 XP_015127767.1.60272 XP_015127769.1.60272 XP_015127911.1.60272 XP_015144912.1.86415 XP_015144926.1.86415 XP_015172623.1.70865 XP_015174269.1.70865 XP_015239599.1.42780 XP_015259910.1.42780 XP_015271251.1.55130 XP_015275046.1.55130 XP_015275052.1.55130 XP_015275949.1.55130 XP_015276803.1.55130 XP_015283909.1.55130 XP_015313451.1.63531 XP_015318079.1.59421 XP_015318510.1.76553 XP_015349604.1.40921 XP_015349605.1.40921 XP_015349635.1.40921 XP_015435345.1.55303 XP_015435409.1.55303 XP_015438102.1.55303 XP_015482669.1.82291 XP_015482670.1.82291 XP_015509429.1.5119 XP_015518891.1.5119 XP_015519705.1.5119 XP_015591765.1.68462 XP_015591825.1.68462 XP_015592092.1.68462 XP_015602101.1.68462 XP_015604780.1.68462 XP_015605295.1.68462 XP_015605775.1.68462 XP_015607422.1.68462 XP_015608404.1.68462 XP_015608727.1.68462 XP_015608946.1.68462 XP_015608949.1.68462 XP_015609282.1.68462 XP_015610365.1.68462 XP_015678128.1.16292 XP_015678752.1.16292 XP_015683802.1.16292 XP_015686318.1.16292 XP_015715688.1.68032 XP_015735620.1.68032 XP_015747086.1.37977 XP_015748861.1.88439 XP_015759834.1.88439 XP_015767169.1.88439 XP_015782442.1.93521 XP_015782443.1.93521 XP_015783952.1.93521 XP_015796985.1.37898 XP_015799298.1.37898 XP_015824657.1.37898 XP_015824672.1.37898 XP_015856621.1.50099 XP_015862816.1.50099 XP_016022787.1.80810 XP_016116219.1.42290 XP_016117822.1.42290 XP_016120604.1.42290 XP_016161413.1.66865 XP_016284616.1.35504 XP_016284617.1.35504 XP_016284618.1.35504 XP_016284619.1.35504 XP_016284620.1.35504 XP_016284621.1.35504 XP_016284622.1.35504 XP_016315144.1.79318 XP_016315145.1.79318 XP_016339322.1.79318 XP_016349970.1.79318 XP_016382105.1.44103 XP_016391201.1.44103 XP_016391202.1.44103 XP_016404460.1.44103 XP_016405935.1.44103 XP_016405936.1.44103 XP_016405937.1.44103 XP_016414859.1.44103 XP_016414860.1.44103 XP_016414861.1.44103 XP_016417844.1.44103 XP_016417849.1.44103 XP_016429753.1.44103 XP_016517861.1.10163 XP_016528774.1.10163 XP_016800322.1.37143 XP_016828437.1.28591 XP_016844794.1.61660 XP_016844795.1.61660 XP_016921426.1.2121 XP_016921507.1.2121 XP_016938459.1.48971 XP_016971672.1.97277 XP_017008585.1.47939 XP_017013033.1.47939 XP_017024865.1.37106 XP_017064344.1.81094 XP_017106840.1.53830 XP_017143960.1.22881 XP_017163143.1.1237 XP_017201409.1.1745 XP_017209523.1.45394 XP_017209710.1.45394 XP_017277032.1.84151 XP_017296159.1.84151 XP_017303688.1.36046 XP_017304873.1.36046 XP_017317801.1.5077 XP_017317898.1.5077 XP_017317998.1.5077 XP_017318021.1.5077 XP_017318130.1.5077 XP_017318155.1.5077 XP_017318277.1.5077 XP_017318304.1.5077 XP_017318396.1.5077 XP_017318420.1.5077 XP_017336153.1.5077 XP_017443211.1.4139 XP_017456207.1.100692 XP_017501844.1.32401 XP_017539061.1.86671 XP_017542378.1.86671 XP_017542379.1.86671 XP_017542559.1.86671 XP_017542610.1.86671 XP_017543981.1.86671 XP_017544744.1.86671 XP_017545149.1.86671 XP_017545470.1.86671 XP_017545611.1.86671 XP_017545615.1.86671 XP_017545697.1.86671 XP_017577360.1.86671 XP_017593293.1.15636 XP_017659770.1.3805 XP_017659771.1.3805 XP_017742429.1.44346 XP_017754146.1.86738 XP_017764545.1.86738 XP_017764546.1.86738 XP_017795688.1.86229 XP_017799274.1.86229 XP_017799299.1.86229 XP_017821715.1.60252 XP_017875197.1.74565 XP_017887567.1.74565 XP_017888231.1.74565 XP_017901510.1.57651 XP_017935619.1.51550 XP_017935680.1.51550 XP_017936268.1.51550 XP_017948258.1.99540 XP_017948260.1.99540 XP_017948261.1.99540 XP_017948262.1.99540 XP_017948263.1.99540 XP_017952904.1.99540 XP_017952905.1.99540 XP_017952907.1.99540 XP_017952908.1.99540 XP_017952916.1.99540 XP_018020061.1.64131 XP_018027835.1.64131 XP_018043633.1.4000 XP_018053673.1.4000 XP_018079657.1.7800 XP_018096294.1.7800 XP_018096295.1.7800 XP_018096296.1.7800 XP_018098036.1.7800 XP_018118226.1.7800 XP_018118227.1.7800 XP_018303946.1.62676 XP_018308301.1.62676 XP_018317580.1.62676 XP_018346673.1.14990 XP_018347985.1.14990 XP_018354982.1.14990 XP_018371716.1.32933 XP_018376139.1.32933 XP_018377217.1.32933 XP_018402853.1.22276 XP_018403159.1.22276 XP_018426137.1.44173 XP_018430285.1.44173 XP_018495587.1.18380 XP_018496121.1.18380 XP_018496133.1.18380 XP_018496134.1.18380 XP_018496199.1.18380 XP_018496210.1.18380 XP_018496211.1.18380 XP_018496213.1.18380 XP_018496218.1.18380 XP_018496219.1.18380 XP_018496220.1.18380 XP_018496274.1.18380 XP_018517454.1.34915 XP_018522752.1.34915 XP_018527035.1.34915 XP_018555962.1.34915 XP_018555969.1.34915 XP_018558348.1.34915 XP_018558886.1.34915 XP_018594707.1.37976 XP_018598581.1.37976 XP_018598656.1.37976 XP_018601782.1.37976 XP_018606669.1.37976 XP_018864905.1.27298 XP_018932259.1.5815 XP_018932349.1.5815 XP_018939467.1.5815 XP_018951140.1.5815 XP_018951440.1.5815 XP_018962199.1.5815 XP_018963822.1.5815 XP_019122958.1.61708 XP_019148007.1.2935 XP_019148009.1.2935 XP_019209865.1.78416 XP_019209866.1.78416 XP_019209877.1.78416 XP_019288558.1.44245 XP_019336408.1.47583 XP_019336409.1.47583 XP_019336410.1.47583 XP_019336412.1.47583 XP_019370487.1.87953 XP_019400709.1.79039 XP_019435472.1.29932 XP_019490030.1.44202 XP_019621234.1.58950 XP_019642907.1.58950 XP_019644916.1.58950 XP_019644927.1.58950 XP_019649311.1.58354 XP_019700202.1.56509 XP_019719183.1.30352 XP_019775619.1.83887 XP_019812180.1.53367 XP_019919684.1.10878 XP_019933535.1.17567 XP_019966763.1.63745 XP_020006752.1.5219 XP_020008946.1.5219 XP_020008947.1.5219 XP_020008948.1.5219 XP_020009083.1.5219 XP_020291626.1.29359 XP_020293367.1.29359 XP_020365572.1.65276 XP_020382249.1.65276 XP_020383648.1.65276 XP_020383655.1.65276 XP_020385994.1.65276 XP_020387042.1.65276 XP_020387224.1.65276 XP_020387226.1.65276 XP_020387285.1.65276 XP_020387310.1.65276 XP_020387867.1.65276 XP_020388474.1.65276 XP_020390556.1.65276 XP_020390673.1.65276 XP_020481864.1.8198 XP_020482225.1.8198 XP_020483512.1.8198 XP_020484151.1.8198 XP_020493398.1.8198 XP_020493399.1.8198 XP_020493409.1.8198 XP_020493411.1.8198 XP_020494143.1.8198 XP_020494162.1.8198 XP_020511844.1.8198 XP_020514267.1.8198 XP_020514268.1.8198 XP_020515584.1.8198 XP_020515994.1.8198 XP_020561612.1.28442 XP_020603057.1.65938 XP_020609378.1.65938 XP_020629753.1.65938 XP_020640192.1.8467 XP_020643574.1.8467 XP_020654599.1.8467 XP_020654601.1.8467 XP_020665171.1.8467 XP_020718381.1.43243 XP_020755548.1.74333 XP_020776280.1.12261 XP_020784573.1.12261 XP_020795360.1.12261 XP_020795377.1.12261 XP_020795378.1.12261 XP_020796740.1.12261 XP_020804039.1.32911 XP_020804708.1.32911 XP_020805817.1.32911 XP_020806118.1.32911 XP_020806125.1.32911 XP_020806127.1.32911 XP_020836137.1.61212 XP_020859699.1.61212 XP_020859709.1.61212 XP_020859729.1.61212 XP_020894112.1.97939 XP_020895987.1.97939 XP_020896798.1.97939 XP_020896922.1.97939 XP_020899533.1.97939 XP_020902784.1.97939 XP_020906581.1.97939 XP_020906582.1.97939 XP_020913117.1.97939 XP_020916261.1.97939 XP_020916526.1.97939 XP_020917548.1.97939 XP_020917665.1.97939 XP_020945585.1.46622 XP_021230384.1.32913 XP_021230468.1.32913 XP_021408522.1.53032 XP_021424196.1.32639 XP_021500539.1.76796 XP_021500540.1.76796 XP_021500550.1.76796 XP_021543744.1.83697 XP_021590090.1.77405 XP_021701438.1.48696 XP_021701440.1.48696 XP_021705634.1.48696 XP_021705825.1.48696 XP_021705826.1.48696 XP_021706175.1.48696 XP_021706666.1.48696 XP_021706667.1.48696 XP_021706806.1.48696 XP_021706807.1.48696 XP_021707704.1.48696 XP_021708004.1.48696 XP_021708291.1.48696 XP_021711153.1.48696 XP_021711154.1.48696 XP_021711156.1.48696 XP_021711157.1.48696 XP_021711158.1.48696 XP_021711159.1.48696 XP_021711160.1.48696 XP_021711161.1.48696 XP_021711162.1.48696 XP_021711163.1.48696 XP_021711164.1.48696 XP_021711165.1.48696 XP_021711167.1.48696 XP_021711168.1.48696 XP_021711169.1.48696 XP_021711170.1.48696 XP_021711171.1.48696 XP_021711172.1.48696 XP_021712018.1.48696 XP_021712019.1.48696 XP_021712023.1.48696 XP_021712099.1.48696 XP_021712100.1.48696 XP_021712156.1.48696 XP_021712158.1.48696 XP_021712167.1.48696 XP_021712168.1.48696 XP_021712176.1.48696 XP_021712177.1.48696 XP_021712192.1.48696 XP_021712194.1.48696 XP_021712207.1.48696 XP_021712209.1.48696 XP_021712222.1.48696 XP_021712223.1.48696 XP_021712315.1.48696 XP_021712316.1.48696 XP_021712326.1.48696 XP_021712331.1.48696 XP_021712332.1.48696 XP_021712440.1.48696 XP_021712469.1.48696 XP_021712687.1.48696 XP_021712688.1.48696 XP_021944358.1.6718 XP_021944361.1.6718 XP_021945444.1.6718 XP_021955207.1.6718 XP_021955208.1.6718 XP_021955633.1.6718 XP_021955634.1.6718 XP_021957150.1.6718 XP_021957318.1.6718 XP_021957825.1.6718 XP_021957826.1.6718 XP_021957895.1.6718 XP_021957896.1.6718 XP_021964417.1.6718 XP_021968068.1.6718 XP_305996.3.40869 XP_307601.3.40869 XP_307606.3.40869 XP_315130.3.40869 XP_318362.3.40869 XP_416193.2.86415 XP_540290.2.84170 XP_560604.5.40869 XP_966487.1.52716 XP_969597.1.52716 XP_969677.1.52716 XP_975418.1.52716 ENSGGOP00000012904 ENSGGOP00000020787 ENSGGOP00000025430 ENSPVAP00000011441 ENSMODP00000031149 ENSSSCP00000020541 ENSSSCP00000025552 ENSSSCP00000025803 ENSDORP00000004905 ENSDORP00000004909 ENSDORP00000004923 ENSDORP00000004926 ENSDORP00000004927 ENSDORP00000008210 ENSDORP00000008233 ENSDORP00000015388 ENSDORP00000015392 ENSDORP00000015396 FBpp0192282 FBpp0192519 FBpp0192625 FBpp0192643 FBpp0192658 FBpp0192661 FBpp0193185 FBpp0193188 FBpp0193551 FBpp0193862 FBpp0194601 FBpp0194616 FBpp0194656 FBpp0194670 FBpp0194673 FBpp0195020 FBpp0195059 FBpp0195103 FBpp0196610 FBpp0196930 FBpp0197585 FBpp0197709 FBpp0197734 FBpp0197757 FBpp0197874 FBpp0198875 FBpp0198919 FBpp0200212 FBpp0200282 FBpp0200788 FBpp0200791 FBpp0200802 FBpp0200820 FBpp0201125 FBpp0201132 FBpp0201186 FBpp0201188 FBpp0201196 FBpp0201199 FBpp0201203 FBpp0201206 FBpp0201215 FBpp0201230 FBpp0201236 FBpp0203427 FBpp0203580 FBpp0204902 FBpp0206444 FBpp0208204 jgi|Nemve1|104848|e_gw.74.103.1 jgi|Nemve1|118897|e_gw.157.55.1 jgi|Nemve1|196006|estExt_GenewiseH_1.C_48670001 jgi|Nemve1|198088|fgenesh1_pg.scaffold_8000129 jgi|Nemve1|200351|fgenesh1_pg.scaffold_21000036 jgi|Nemve1|212541|fgenesh1_pg.scaffold_157000060 jgi|Nemve1|220095|fgenesh1_pg.scaffold_474000006 jgi|Nemve1|227630|fgenesh1_kg.scaffold_474000002 jgi|Nemve1|227737|fgenesh1_kg.scaffold_3263000002 jgi|Nemve1|227739|fgenesh1_kg.scaffold_3491000001 jgi|Nemve1|227771|fgenesh1_kg.scaffold_5989000001 jgi|Nemve1|227772|fgenesh1_kg.scaffold_6208000001 jgi|Nemve1|227782|fgenesh1_kg.scaffold_6829000002 jgi|Nemve1|227799|fgenesh1_kg.scaffold_8416000001 jgi|Nemve1|228351|fgenesh1_pm.scaffold_14000026 jgi|Nemve1|229546|fgenesh1_pm.scaffold_84000009 jgi|Nemve1|83663|e_gw.8.226.1 jgi|Nemve1|83858|e_gw.8.223.1 jgi|Nemve1|83955|e_gw.8.199.1 jgi|Nemve1|89555|e_gw.21.179.1 ENSTRUP00000004156 ENSTRUP00000004722 ENSTRUP00000004739 ENSTRUP00000007762 ENSTRUP00000007825 ENSTRUP00000008613 ENSTRUP00000009808 ENSTRUP00000039546 ENSTRUP00000039676 ENSTRUP00000039717 ENSTRUP00000044342 ENSP00000333277 ENSP00000358154 ENSP00000385479 ENSP00000463420 ENSP00000463798 ENSP00000463995 ENSOCUP00000016501 ENSOCUP00000017598 ENSTBEP00000013105 ENSOPRP00000009819 ENSOPRP00000009833 ENSOPRP00000011503 ENSACAP00000003255 ENSACAP00000003271 ENSACAP00000004282 ENSACAP00000010511 ENSACAP00000021479 ENSFCAP00000018263 ENSFCAP00000022577 jgi|Dappu1|235586|SNAP_00003644 jgi|Dappu1|235594|SNAP_00003652 jgi|Dappu1|235620|SNAP_00003678 jgi|Dappu1|235802|SNAP_00003860 jgi|Dappu1|255862|SNAP_00023920 jgi|Dappu1|304645|PASA_GEN_0300065 jgi|Dappu1|43402|e_gw1.6.863.1 jgi|Dappu1|43405|e_gw1.6.847.1 jgi|Dappu1|43440|e_gw1.6.204.1 jgi|Dappu1|43441|e_gw1.6.805.1 jgi|Dappu1|43467|e_gw1.6.767.1 jgi|Dappu1|43482|e_gw1.6.872.1 jgi|Dappu1|43597|e_gw1.6.831.1 jgi|Dappu1|43602|e_gw1.6.815.1 jgi|Dappu1|43862|e_gw1.6.195.1 jgi|Dappu1|43863|e_gw1.6.796.1 jgi|Dappu1|43874|e_gw1.6.800.1 jgi|Dappu1|44114|e_gw1.6.811.1 jgi|Dappu1|44115|e_gw1.6.202.1 jgi|Dappu1|44116|e_gw1.6.803.1 jgi|Dappu1|44125|e_gw1.6.888.1 jgi|Dappu1|44149|e_gw1.6.376.1 jgi|Dappu1|44153|e_gw1.6.862.1 jgi|Dappu1|67712|e_gw1.1025.5.1 ENSSARP00000009328 ENSTBEP00000013105 ENSNLEP00000022184 ENSEEUP00000005554 TC001497 TC005139 TC006933 TC016050 ENSAPLP00000001550 ENSAPLP00000001713 ENSAPLP00000001736 ENSAPLP00000001762 ENSAPLP00000001763 Cflo_00128--XP_001120304.1_APIME Cflo_02892--XP_001120304.1_APIME Cflo_07631--XP_001120304.1_APIME ENSMMUP00000039192 ENSCJAP00000040835 ENSGMOP00000021196 ENSGMOP00000021201 ENSGMOP00000021230 ENSGMOP00000021353 ENSGMOP00000021371 ENSGMOP00000021503 ENSGMOP00000021687 ENSGMOP00000021691 ENSGMOP00000021920 ENSGMOP00000021922 ENSLAFP00000025246 ENSLAFP00000026689 ENSOGAP00000005582 ENSOGAP00000015582 ENSOGAP00000020175 ENSP00000333277 ENSP00000358154 ENSP00000385479 ENSXETP00000057894 ENSXETP00000059443 ENSXETP00000061513 ENSXETP00000063239 ENSXETP00000063378 ENSCSAVP00000002687 ENSCSAVP00000013284 ENSTRUP00000004156 ENSTRUP00000004722 ENSTRUP00000004739 ENSTRUP00000007762 ENSTRUP00000007825 ENSTRUP00000008613 ENSTRUP00000009808 ENSTRUP00000039546 ENSTRUP00000039676 ENSTRUP00000039717 ENSTRUP00000044342 gi|116248095|sp|Q28D37| gi|301623047|gb|XP_002940831| gi|301623061|gb|XP_002940834| gi|301623149|gb|XP_002940882| gi|301623161|gb|XP_002940878| gi|301623165|gb|XP_002940887| gi|301623179|gb|XP_002940898| gi|301623183|gb|XP_002940899| gi|301624179|gb|XP_002941385| gi|301624199|gb|XP_002941390| gi|301624218|gb|XP_002941388| gi|301626318|gb|XP_002942339| gi|301626328|gb|XP_002942344| gi|301627466|gb|XP_002942898| gi|301627474|gb|XP_002942904| gi|301628144|gb|XP_002943219| gi|301628152|gb|XP_002943223| gi|301628506|gb|XP_002943392| gi|301628508|gb|XP_002943393| gi|301628779|gb|XP_002943524| gi|301631066|gb|XP_002944630| gi|301631129|gb|XP_002944659| gi|301631764|gb|XP_002944964| gi|301631766|gb|XP_002944966| gi|301632002|gb|XP_002945081| gi|301632523|gb|XP_002945333| gi|301632586|gb|XP_002945363| gi|62860150|ref|NP_001016636| gi|89269517|gb|CAJ82338| gi|89270410|gb|CAJ82528| FBpp0210268 FBpp0210389 FBpp0210997 FBpp0211101 FBpp0211438 FBpp0212068 FBpp0212858 FBpp0213254 FBpp0213515 FBpp0213836 FBpp0214155 FBpp0216400 FBpp0217407 FBpp0220388 FBpp0085250 FBpp0091051 FBpp0091053 FBpp0091056 FBpp0091058 FBpp0091061 FBpp0091064 FBpp0091067 FBpp0091070 FBpp0091073 FBpp0091076 FBpp0091079 FBpp0091082 FBpp0091085 FBpp0091088 FBpp0091091 FBpp0091094 FBpp0091097 FBpp0091100 FBpp0091103 FBpp0091106 FBpp0091109 FBpp0091112 ENSLAFP00000025246 ENSLAFP00000026689 10090.ENSMUSP00000074994 10090.ENSMUSP00000089295 10090.ENSMUSP00000096442 10090.ENSMUSP00000097295 10090.ENSMUSP00000100737 10090.ENSMUSP00000100739 10116.ENSRNOP00000040167 10116.ENSRNOP00000044600 10116.ENSRNOP00000044831 10141.ENSCPOP00000011305 10141.ENSCPOP00000014014 10141.ENSCPOP00000015482 10141.ENSCPOP00000017453 10141.ENSCPOP00000018022 10141.ENSCPOP00000018625 10228.JGI24875 13616.ENSMODP00000031149 28377.ENSACAP00000003271 28377.ENSACAP00000004282 28377.ENSACAP00000004577 28377.ENSACAP00000010511 31033.ENSTRUP00000004156 31033.ENSTRUP00000004722 31033.ENSTRUP00000004739 31033.ENSTRUP00000007762 31033.ENSTRUP00000007825 31033.ENSTRUP00000008613 31033.ENSTRUP00000009808 31033.ENSTRUP00000039546 31033.ENSTRUP00000039676 31033.ENSTRUP00000039717 31033.ENSTRUP00000044342 45351.JGI104848 45351.JGI118897 45351.JGI196006 45351.JGI198088 45351.JGI200351 45351.JGI212541 45351.JGI220095 45351.JGI227630 45351.JGI227737 45351.JGI227739 45351.JGI227771 45351.JGI227772 45351.JGI227782 45351.JGI227799 45351.JGI228351 45351.JGI229546 45351.JGI83663 45351.JGI83858 45351.JGI83955 45351.JGI89555 51511.ENSCSAVP00000002687 51511.ENSCSAVP00000013284 59729.ENSTGUP00000009582 59729.ENSTGUP00000009587 59729.ENSTGUP00000009589 59729.ENSTGUP00000009609 59729.ENSTGUP00000009656 59729.ENSTGUP00000009659 59729.ENSTGUP00000015076 7159.AAEL000482-PA 7159.AAEL000492-PA 7159.AAEL000506-PA 7159.AAEL003659-PA 7159.AAEL003828-PA 7159.AAEL003836-PA 7159.AAEL003850-PA 7159.AAEL003852-PA 7159.AAEL003856-PA 7159.AAEL012072-PA 7165.AGAP003910-PA 7165.AGAP005024-PA 7165.AGAP005025-PA 7165.AGAP012559-PA 7165.AGAP012572-PA 7165.AGAP012573-PA 7176.CPIJ006050-PA 7176.CPIJ012379-PA 7176.CPIJ012384-PA 7176.CPIJ012389-PA 7176.CPIJ012394-PA 7176.CPIJ012402-PA 7176.CPIJ012411-PA 7176.CPIJ012418-PA 7176.CPIJ012424-PA 7176.CPIJ014769-PA 7176.CPIJ015006-PA 7217.FBpp0119079 7217.FBpp0119114 7217.FBpp0123357 7217.FBpp0123551 7217.FBpp0123572 7217.FBpp0124714 7217.FBpp0124800 7217.FBpp0124861 7217.FBpp0125392 7217.FBpp0125457 7217.FBpp0125485 7217.FBpp0126047 7222.FBpp0144055 7222.FBpp0144077 7222.FBpp0147842 7222.FBpp0157238 7222.FBpp0157240 7222.FBpp0157245 7222.FBpp0157250 7222.FBpp0157375 7222.FBpp0157410 7222.FBpp0157419 7222.FBpp0157478 7222.FBpp0157655 7222.FBpp0157668 7222.FBpp0157671 7222.FBpp0157782 7222.FBpp0158855 7222.FBpp0158906 7222.FBpp0159054 7222.FBpp0159058 7222.FBpp0159061 7222.FBpp0159064 7222.FBpp0159066 7222.FBpp0159068 7222.FBpp0159071 7222.FBpp0159074 7222.FBpp0159079 7222.FBpp0159082 7222.FBpp0159083 7222.FBpp0159085 7222.FBpp0159089 7222.FBpp0159091 7227.FBpp0085250 7227.FBpp0091051 7227.FBpp0091053 7227.FBpp0091056 7227.FBpp0091058 7227.FBpp0091061 7227.FBpp0091064 7227.FBpp0091067 7227.FBpp0091070 7227.FBpp0091073 7227.FBpp0091076 7227.FBpp0091079 7227.FBpp0091082 7227.FBpp0091085 7227.FBpp0091088 7227.FBpp0091091 7227.FBpp0091094 7227.FBpp0091097 7227.FBpp0091100 7227.FBpp0091103 7227.FBpp0091106 7227.FBpp0091109 7227.FBpp0091112 7244.FBpp0229582 7244.FBpp0229865 7244.FBpp0230530 7244.FBpp0230761 7244.FBpp0230763 7244.FBpp0231492 7244.FBpp0232818 7244.FBpp0232822 7244.FBpp0233002 7244.FBpp0234228 7244.FBpp0236954 7244.FBpp0236969 7244.FBpp0237002 7244.FBpp0238109 7244.FBpp0238111 7244.FBpp0238115 7244.FBpp0238118 7244.FBpp0238120 7244.FBpp0238124 7244.FBpp0238128 7260.FBpp0239523 7260.FBpp0248036 7260.FBpp0248300 7260.FBpp0248380 7260.FBpp0250275 7719.ENSCINP00000005615 7739.JGI113377 7739.JGI115926 7739.JGI274816 7739.JGI285546 7739.JGI56969 7739.JGI56970 7739.JGI56975 7739.JGI60623 7739.JGI60630 7739.JGI62634 7739.JGI62637 7739.JGI64755 7739.JGI64769 7739.JGI64784 7739.JGI64800 7739.JGI64812 7739.JGI64865 7739.JGI93897 7955.ENSDARP00000067892 7955.ENSDARP00000084277 7955.ENSDARP00000090633 7955.ENSDARP00000093742 7955.ENSDARP00000093745 7955.ENSDARP00000098445 7955.ENSDARP00000098481 7955.ENSDARP00000098646 7955.ENSDARP00000098674 7955.ENSDARP00000101193 7955.ENSDARP00000102017 7955.ENSDARP00000103246 8090.ENSORLP00000001653 8364.ENSXETP00000027203 8364.ENSXETP00000030180 8364.ENSXETP00000052672 8364.ENSXETP00000053642 8364.ENSXETP00000053645 8364.ENSXETP00000053650 8364.ENSXETP00000054134 8364.ENSXETP00000054438 8364.ENSXETP00000055003 8364.ENSXETP00000055180 8364.ENSXETP00000055238 8364.ENSXETP00000055615 8364.ENSXETP00000055687 8364.ENSXETP00000056111 8364.ENSXETP00000056112 8364.ENSXETP00000056120 8364.ENSXETP00000056204 8364.ENSXETP00000056591 8364.ENSXETP00000056593 8364.ENSXETP00000056850 8364.ENSXETP00000056880 8364.ENSXETP00000056887 8364.ENSXETP00000056893 8364.ENSXETP00000057368 8364.ENSXETP00000057372 8364.ENSXETP00000057374 8364.ENSXETP00000057459 8364.ENSXETP00000057460 8364.ENSXETP00000057894 8364.ENSXETP00000057899 8364.ENSXETP00000057901 8364.ENSXETP00000058080 8364.ENSXETP00000058081 8364.ENSXETP00000058157 9031.ENSGALP00000031319 9031.ENSGALP00000037294 9031.ENSGALP00000037310 9258.ENSOANP00000000329 9258.ENSOANP00000005893 9361.ENSDNOP00000009059 9544.ENSMMUP00000039192 9598.ENSPTRP00000002098 9598.ENSPTRP00000048353 9600.ENSPPYP00000001074 9600.ENSPPYP00000022371 9606.ENSP00000333277 9606.ENSP00000358154 9606.ENSP00000385479 9796.ENSECAP00000001522 9796.ENSECAP00000005899 9823.ENSSSCP00000007114 9823.ENSSSCP00000007119 9913.ENSBTAP00000050952 9913.ENSBTAP00000053067 9986.ENSOCUP00000016501 9986.ENSOCUP00000017598 99883.ENSTNIP00000000561 99883.ENSTNIP00000005044 99883.ENSTNIP00000010417 99883.ENSTNIP00000011592 99883.ENSTNIP00000011621 ENSDORP00000004905 ENSDORP00000004909 ENSDORP00000004923 ENSDORP00000004926 ENSDORP00000004927 ENSDORP00000008210 ENSDORP00000008233 ENSDORP00000015388 ENSDORP00000015392 ENSDORP00000015396 EKC28014 EKC28020 EKC28025 EKC28030 EKC28035 ENSOANP00000000329 ENSOANP00000005893 AC06784-PA AC06941-PA AC12742-PA ENSPTRP00000002098 ENSPTRP00000048353 ENSNLEP00000022184 ENSPSIP00000000616 ENSPSIP00000001384 ENSPSIP00000001666 ENSPSIP00000001689 FBpp0119079 FBpp0119114 FBpp0123357 FBpp0123551 FBpp0123572 FBpp0124714 FBpp0124800 FBpp0124861 FBpp0125392 FBpp0125457 FBpp0125485 FBpp0126047 ENSETEP00000009942 gi|109157556|gb|2F8N_A| gi|109157559|gb|2F8N_E| gi|133737012|gb|AAI33777| gi|148236633|ref|NP_001091428| gi|214279|gb|AAA49765| gi|455387|gb|AAA49770| gi|55977061|sp|P84233| gi|64772|gb|CAA26813| gi|64778|gb|CAA26818| gi|64781|gb|CAA26890| ENSXMAP00000019686 ENSMMUP00000039192 ENSCHOP00000000504 ENSCHOP00000003516 ENSOPRP00000009819 ENSOPRP00000009833 ENSOPRP00000011503 ENSCJAP00000040835 ENSMICP00000000254 ENSMICP00000000256 ENSMICP00000000259 ENSRNOP00000044600 ENSRNOP00000065312 ENSRNOP00000066277 ENSRNOP00000067504 ENSRNOP00000067675 FBpp0229582 FBpp0229865 FBpp0230530 FBpp0230761 FBpp0230763 FBpp0231492 FBpp0232818 FBpp0232822 FBpp0233002 FBpp0234228 FBpp0236954 FBpp0236969 FBpp0237002 FBpp0238109 FBpp0238111 FBpp0238115 FBpp0238118 FBpp0238120 FBpp0238124 FBpp0238128 ENSECAP00000001522 ENSECAP00000005899 ENSBTAP00000050291 ENSBTAP00000050952 ENSBTAP00000053067 ENSPVAP00000011441 ENSPCAP00000003045 ENSOGAP00000005582 ENSOGAP00000015582 ENSOGAP00000020175 FBpp0239523 FBpp0248036 FBpp0248300 FBpp0248380 FBpp0250275 PB15222-RA PB15655-RA PB16064-RA PB21863-RA ENSDNOP00000009059 Aqu1.205684|PACid:15704212 ENSOARP00000013930 gi|193582486|ref|XP_001950199.1| gi|193676675|ref|XP_001951147.1| ENSCPOP00000011305 ENSCPOP00000014014 ENSCPOP00000015482 ENSCPOP00000017453 ENSCPOP00000018022 ENSCPOP00000018625 ENSXETP00000057894 ENSXETP00000059443 ENSXETP00000061513 ENSXETP00000063239 ENSXETP00000063378 GSOIDT00001655001 ENSPFOP00000020963 ENSMEUP00000000617 ENSMEUP00000000820 ENSMEUP00000005435 ENSMEUP00000008882 Ocbimv22001065m.p Ocbimv22023920m.p Ocbimv22032927m.p Ocbimv22036525m.p ENSCAFP00000041760 ENSBTAP00000050291 ENSBTAP00000050952 ENSBTAP00000053067 ENSORLP00000001653 ENSACAP00000003255 ENSACAP00000003271 ENSACAP00000004282 ENSACAP00000010511 ENSACAP00000021479 jgi|Capca1|103051|e_gw1.59.76.1 jgi|Capca1|106383|e_gw1.1238.11.1 jgi|Capca1|113088|e_gw1.96.117.1 jgi|Capca1|114963|e_gw1.3574.8.1 jgi|Capca1|128643|e_gw1.3556.8.1 jgi|Capca1|139827|e_gw1.5510.10.1 jgi|Capca1|140172|e_gw1.66.110.1 jgi|Capca1|143680|e_gw1.7.113.1 jgi|Capca1|145086|e_gw1.469.70.1 jgi|Capca1|145096|e_gw1.469.68.1 jgi|Capca1|146003|e_gw1.340.41.1 jgi|Capca1|177743|estExt_Genewise1Plus.C_3780017 jgi|Capca1|183410|estExt_Genewise1Plus.C_90200011 jgi|Capca1|185601|fgenesh1_pg.C_scaffold_163000049 jgi|Capca1|4232|fgenesh1_pm.C_scaffold_13000012 jgi|Capca1|91648|e_gw1.16157.6.1 jgi|Capca1|96020|e_gw1.324.38.1 jgi|Capca1|97620|e_gw1.2980.17.1 jgi|Capca1|98969|e_gw1.482.45.1 TRIUR3_35196-P1 AGAP003910-PA AGAP005024-PA AGAP005025-PA AGAP012559-PA AGAP012572-PA AGAP012573-PA ENSSSCP00000020541 ENSSSCP00000025552 ENSSSCP00000025803 ENSCHOP00000000504 ENSCHOP00000003516 ENSSARP00000009328 ENSMODP00000031149 FBpp0144055 FBpp0144077 FBpp0147842 FBpp0157238 FBpp0157240 FBpp0157245 FBpp0157250 FBpp0157375 FBpp0157410 FBpp0157419 FBpp0157478 FBpp0157655 FBpp0157668 FBpp0157671 FBpp0157782 FBpp0158855 FBpp0158906 FBpp0159054 FBpp0159058 FBpp0159061 FBpp0159064 FBpp0159066 FBpp0159068 FBpp0159071 FBpp0159074 FBpp0159079 FBpp0159082 FBpp0159083 FBpp0159085 FBpp0159089 FBpp0159091 ENSPCAP00000003045 ENSVPAP00000000469 HGL_H00000385479-1 HGL_H00000385479-3 AAEL000482-PA AAEL000492-PA AAEL000506-PA AAEL003659-PA AAEL003828-PA AAEL003836-PA AAEL003850-PA AAEL003852-PA AAEL003856-PA AAEL012072-PA ENSFALP00000015554 ENSFALP00000015624 ENSFALP00000015678 ENSFALP00000015723 jgi|Lotgi1|145440|e_gw1.324.2.1 jgi|Lotgi1|146472|e_gw1.829.18.1 jgi|Lotgi1|147117|e_gw1.2012.14.1 jgi|Lotgi1|147816|e_gw1.4467.3.1 jgi|Lotgi1|147849|e_gw1.4597.21.1 jgi|Lotgi1|148546|e_gw1.9711.8.1 ENSMGAP00000008111 Aech_07569 ENSDARP00000084277 ENSDARP00000101193 ENSDARP00000112824 ENSDARP00000113307 LH20877-PA LH21289-PA LH21967-PA ENSTGUP00000009582 ENSTGUP00000009587 ENSTGUP00000009589 ENSTGUP00000009609 ENSTGUP00000009656 ENSTGUP00000009659 ENSTGUP00000015076 ENSCPOP00000011305 ENSCPOP00000014014 ENSCPOP00000015482 ENSCPOP00000017453 ENSCPOP00000018022 ENSCPOP00000018625 ENSECAP00000001522 ENSECAP00000005899 OB0207G10020.1 FBpp0085250 FBpp0091051 FBpp0091053 FBpp0091056 FBpp0091058 FBpp0091061 FBpp0091064 FBpp0091067 FBpp0091070 FBpp0091073 FBpp0091076 FBpp0091079 FBpp0091082 FBpp0091085 FBpp0091088 FBpp0091091 FBpp0091094 FBpp0091097 FBpp0091100 FBpp0091103 FBpp0091106 FBpp0091109 FBpp0091112 ENSGALP00000040958 ENSGALP00000042290 ENSDNOP00000025889 ENSMGAP00000008111 ENSPANP00000011861 ENSPPYP00000001074 ENSPPYP00000022371 SSCA001181-PA SMAR000116-PA gi|156536991|ref|XP_001608284.1| gi|156538959|ref|XP_001599673.1| gi|156539583|ref|XP_001599163.1| gi|156544927|ref|XP_001603659.1| gi|156544954|ref|XP_001607608.1| gi|156544956|ref|XP_001607616.1| gi|156544958|ref|XP_001607613.1| gi|156544976|ref|XP_001607935.1| gi|156548576|ref|XP_001607330.1| gi|156548634|ref|XP_001608235.1| gi|156548638|ref|XP_001608238.1| gi|156553440|ref|XP_001599561.1| gi|156553442|ref|XP_001599419.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]