SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0099498 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0099498
Domain Number 1 Region: 11-273
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.01e-91
Family Protein kinases, catalytic subunit 0.00000182
Further Details:      
 
Domain Number 2 Region: 371-499
Classification Level Classification E-value
Superfamily NTF2-like 3.26e-40
Family Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A 0.000002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0099498   Gene: FBgn0264607   Transcript: FBtr0100148
Sequence length 516
Comment pep:known chromosome:BDGP5:4:1055914:1074329:-1 gene:FBgn0264607 transcript:FBtr0100148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPAACTRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLER
EARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQI
LESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGY
LSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDT
VTPEAKNLINQMLTVNPNKRITAAEALKHPWICQRERVASVVHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSSRSMITKKGEGSQVKESTDSSSTTLEDDDIKEDKKGTVDRSTTVV
SKEPEVNLFTNKAARRQEIIKITEQLIEAINSGDFDGYTKICDPHLTAFEPEALGNLVEG
IDFHKFYFENVLGKNCKAINTTILNPHVHLLGEEAACIAYVRLTQYIDKQGHAHTHQSEE
TRVWHKRDNKWQNVHFHRSASAKISGATTFDFIPQK
Download sequence
Identical sequences NP_001014696.1.81976 FBpp0099498 FBpp0099498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]