SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0111920 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0111920
Domain Number 1 Region: 4-128
Classification Level Classification E-value
Superfamily NTF2-like 9.57e-39
Family NTF2-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0111920   Gene: FBgn0031145   Transcript: FBtr0113007
Sequence length 129
Comment pep:known chromosome:BDGP5:X:20906496:20910570:1 gene:FBgn0031145 transcript:FBtr0113007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLNPQYEDIGKGFVQQYYAIFDDPANRANVVNFYSATDSFMTFEGHQIQGAPKILEKVQ
SLSFQKITRVITTVDSQPTFDGGVLINVLGRLQTDEDQPHAYIQTFVLKPVGGSFFVQHD
IFRLSLHDV
Download sequence
Identical sequences A8JUT4
FBpp0111920 NP_001097040.1.81976 XP_017004387.1.47939 FBpp0111920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]