SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0113081 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0113081
Domain Number 1 Region: 459-552
Classification Level Classification E-value
Superfamily TAFH domain-like 1.19e-32
Family TAFH domain-like 0.00034
Further Details:      
 
Domain Number 2 Region: 878-927
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000000167
Family TBP-associated factors, TAFs 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0113081   Gene: FBgn0010280   Transcript: FBtr0114589
Sequence length 1088
Comment pep:known chromosome:BDGP5:3L:16106312:16114468:1 gene:FBgn0010280 transcript:FBtr0114589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTSQTAAGNRITFTSQPLPNGTISIAGNPGAVISTAQLPNTTTIKTIQAGIGGQHQGLQ
QVHHVQQQQQSQQQQQQQQQTQSVGATQTQTLVIKSNHHAVTLPAGLVSSAPAGIVTMTK
TINQAGQPLLNSMLPAGVVVGMRQQAPSQQQQKNVPTNPLSRVVINSHMAGVRPQSPSIT
LSTLNTGQTPALLVKTDNGFQLLRVGTTTGPPTVTQTITNTSNNSNTTSTTNHPTTTQIR
LQTVPAAAVSRYQQQQQHQQQSQQQQQSQQQQHATSTTASTSIALRKTIVRTSSTVPSSN
NNNNSINATTNTTTTTTTNNNNKPATNQQQQQQKLQQQQHLKAQQQQKQQQASAAAAAAA
AAANVAATIKIKQNSMTNTTATSNIIVNSVASSGYANSSQPPHLTQLNAQAPQLPQITQI
QTIPAQQSQQQQVNNVSSAGGTATAVSSTTAATTTQQGNTKEKCRKFLANLIELSTREPK
PVEKNVRTLIQELVNANVEPEEFCDRLERLLNASPQPCLIGFLKKSLPLLRQALYTKELV
IEGIKPPPQHVLGLAGLSQQLPKIQAQIRPIGPSQTTTIGQTQVRMITPNALGTPRPTIG
HTTISKQPPNIRLPTAPRLVNTGGIRTQIPSLQVPGQANIVQIRGPQHAQLQRTGSVQIR
ATTRPPNSVPTANKLTAVKVGQTQIKAITPSLHPPSLAAISGGPPPTPTLSVLSTLNSAS
TTTLPIPSLPTVHLPPEALRAREQMQNSLNHNSNHFDAKLVEIKAPSLHPPHMERINASL
TPIGAKTMARPPPAINKAIGKKKRDAMEMDAKLNTSSGGAASAANSFFQQSSMSSMYGDD
DINDVAAMGGVNLAEESQRILGCTENIGTQIRSCKDEVFLNLPSLQARIRAITSEAGLDE
PSQDVAVLISHACQERLKNIVEKLAVIAEHRIDVIKLDPRYEPAKDVRGQIKFLEELDKA
EQKRHEELEREMLLRAAKSRSRVEDPEQAKMKARAKEMQRAEMEELRQRDANLTALQAIG
PRKKLKLDGETVSSGAGSSGGGVLSSSGSAPTTLRPRIKRVNLRDMLFYMEQEREFCRSS
MLFKTYLK
Download sequence
Identical sequences B7Z060
FBpp0113081 FBpp0113081 NP_001137958.1.81976 7227.FBpp0113081 FBpp0075207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]