SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0289606 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289606
Domain Number 1 Region: 11-273
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.47e-91
Family Protein kinases, catalytic subunit 0.00000182
Further Details:      
 
Domain Number 2 Region: 348-473
Classification Level Classification E-value
Superfamily NTF2-like 6.27e-40
Family Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A 0.000002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289606   Gene: FBgn0264607   Transcript: FBtr0300377
Sequence length 490
Comment pep:known chromosome:BDGP5:4:1057781:1072004:-1 gene:FBgn0264607 transcript:FBtr0300377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPAACTRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLER
EARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQI
LESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGY
LSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDT
VTPEAKNLINQMLTVNPNKRITAAEALKHPWICQRERVASVVHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSSRSMITKKGEGSQVKESTDSSSTTLEDDDIKAARRQEIIKITEQL
IEAINSGDFDGYTKICDPHLTAFEPEALGNLVEGIDFHKFYFENVLGKNCKAINTTILNP
HVHLLGEEAACIAYVRLTQYIDKQGHAHTHQSEETRVWHKRDNKWQNVHFHRSASAKISG
ATTFDFIPQK
Download sequence
Identical sequences A0A0J9S162 A4V133
NP_001162831.1.81976 NP_524635.3.81976 NP_726633.2.81976 XP_016037418.1.80810 FBpp0088281 FBpp0088282 FBpp0289606 FBpp0088281 FBpp0088282 FBpp0289606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]