SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0289752 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289752
Domain Number 1 Region: 992-1100
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-24
Family PDZ domain 0.00014
Further Details:      
 
Domain Number 2 Region: 257-347
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.45e-24
Family Ras-binding domain, RBD 0.00019
Further Details:      
 
Domain Number 3 Region: 375-469
Classification Level Classification E-value
Superfamily SMAD/FHA domain 6.91e-20
Family FHA domain 0.00039
Further Details:      
 
Domain Number 4 Region: 40-130
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.76e-18
Family Ras-binding domain, RBD 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289752   Gene: FBgn0259212   Transcript: FBtr0300525
Sequence length 2051
Comment pep:known chromosome:BDGP5:3R:999324:1043147:-1 gene:FBgn0259212 transcript:FBtr0300525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHDKKMLDREAVRSVIQQWNANRLDLFALSEPDENLLFHGVMRFYFQDAGQKVATKCIR
VASDATVTDVIDTLIEKFRPDMRMLSVPNYALYEVHANGEERRLNADEKPLLVQLNWHID
DREGRFLLKNIDQKTTPIEQTDLNFKRKLSKREKKEQKKKEKMAKLSSDPPTSNGSHLGL
GNGVGASSGSAHMNGNAGGTGGDSSDAVAGKLYTELPETSFTRSISNPEAVMRRRRQQKL
EKKLQQFRSRDGGPDTGGTLKIYGESLCQDVPYKTLLLSIRDCAQAVVREMLTKYGLEKA
DPLHYCLVQVNSDGTEYILDDDECPLSILMNHPTSRGSIMFHVRRRPADSQPRRRKKKPL
GAANGANHISGDREGPVLVEVTHSGDGGRRIKLGSDPVEVGSANTNCLQLFGPSIQPRHC
LISLLEGVCTVTPLHTDALTFVNGHHISQPTILHNGSVVMFGRVASYRFLDSPTDGRYNL
ALSQSQLDSACLYESRSPTSPGSWNDEDGALSSTHKSDYDHHQQANHSSAYHNNNNNSSD
HPLSSTLRDVVDSKAGQDQGANSGNYDGQSLEGNLENETKSISSLKSGGSNSQDRSPKMT
GSGILAGGGSGSGDTQGQEPILPAVLEFPETHQELFLRHIISELDVNVPHFKLAPVYSLY
LCARYRASTHYRPELQPTERAHKLTMFLHHVANLVYSVVQEQYTDPRILAFWMANSSEFL
HFLKSDRHISAFSVQAQEVLAEAVQTAFRNLVNCFRLELSQTLNQFLSENIDHDSAAGLV
LTVLGSAMALLRRCRVNAALTIQLFSQLFHYINVICFNTIVANSQMCTGDWGKVMTERLQ
LLELWAERQGLELAADCHLAKINQCAQFLQAPKSSVEEIQQLACSCFRLNSLQMAALLQQ
EKLPRNLVDTAIRMAESVADELTRADGREVRLEESPELHLALLLPDDGFSCDVVRGIPTG
LVDFLNPLQQQGMCRLAAQPTSIGLWTVYMHQFNARSSSAMSNKLPQPELQLIKLHKNSN
GMGLSIVAAKGAGQEKLGIYIKSVVPGGAADADGRLQAGDQLLRVDGQSLIGITQERAAD
YLVRTGPVVSLEVAKQGAIYHGLATLLQQPSPVIQRGNRRMSERDLTRMGGAESTKSLGP
LIANNHPNHSLSLSQHLNNSHNNTLGNSNNSSIINPLAAHLPNSKSVPALHHHTGSGTIS
LANSKSRSTHSLHNNTSGMGGIGGAAAGGMLGQPNGSQNNANGNGNGNEQGFYQNLSVYR
AQNQSQPILNERPPIAAHAAMNAYNGSSPLAPQQQPQQQQQSPYQQQQQQQHMQANANLP
PTRPVSAYYHSQQSAQQQLQQQQQQQQQHSLQQQQFALSSGNLNGQQQQQQQHQHQHQLT
LNNRTKSQQNFQHTLRMQQMMAPSMPNISNMYHHQQQQQQQLPLQQQQQQQQQPLMSSSQ
SMQNVNDFAGGYQNGSLEYRRSQLHDPSTLYEIQQQQLQQQQQQQQQQQQQQQASPNFIA
LPPKPLGSLQSPNKPNVPPSTAPKPQQDKPPLPPTATHPLFKATQQIAPGMNYVASTLDP
PKGSYVASNQGNNRPLHSGSNPWEREEREKDLEMRREHIRQWREQQISELSQIVSRSPMQ
EEQLKTLILERDFERRAQELQEQEEQDQEQQYDKENVQELFRLAGGGQVSAIQTPITSYR
QTEIKLAEMPDSNSLVDSVPPQPPAPTAQPLSSNTQQPKSILKHNRYSEGGVGPSGAPSS
PSKSQKSASFADERHLHTEHPISNLAKELNQLTMLDKDNNNETLDAVVPPPPPPERNSSY
LIMSQQKLRGSTGNATSSMGLLKTATSNQAAAAVEIKKASLLNTQTNNNNNLSGSLNNNT
MHGSPLSAMELNAAYVSATGTGIIGGLGTPPPPPPLMQRDNKRVSFHDEENNFVSGNSQQ
QQLQQQYIMDNYGMEHQDLDTIREDTSYLQHNLDASMLPSMPATPDAALWNTSVQSTPGV
IGAQEVYRDPRTRRLAEKQQQQQQQRAGDAVPEKLSFKEKMKMFALESGEDKTPKDKLKI
SRAQRDIDAVH
Download sequence
Identical sequences Q9VN82
FBpp0289752 7227.FBpp0289752 NP_001303494.1.81976 NP_524232.2.81976 FBpp0289752 FBpp0289752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]