SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0290808 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290808
Domain Number 1 Region: 219-327
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.24e-31
Family Calponin-homology domain, CH-domain 0.0000275
Further Details:      
 
Domain Number 2 Region: 3154-3313
Classification Level Classification E-value
Superfamily Spectrin repeat 5.55e-27
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 3 Region: 4019-4178
Classification Level Classification E-value
Superfamily Spectrin repeat 7.33e-27
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 4 Region: 4170-4291
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-26
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 5 Region: 338-455
Classification Level Classification E-value
Superfamily Spectrin repeat 4.84e-25
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 6 Region: 5126-5201
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.96e-22
Family GAS2 domain 0.00056
Further Details:      
 
Domain Number 7 Region: 3927-4068
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-22
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 8 Region: 2403-2552
Classification Level Classification E-value
Superfamily Spectrin repeat 5.89e-22
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 9 Region: 2740-2873
Classification Level Classification E-value
Superfamily Spectrin repeat 9.71e-22
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 10 Region: 4370-4508
Classification Level Classification E-value
Superfamily Spectrin repeat 1.02e-21
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 11 Region: 3265-3410
Classification Level Classification E-value
Superfamily Spectrin repeat 1.3e-20
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 12 Region: 3689-3836
Classification Level Classification E-value
Superfamily Spectrin repeat 1.87e-20
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number 13 Region: 4573-4694
Classification Level Classification E-value
Superfamily Spectrin repeat 2.26e-20
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 14 Region: 745-866
Classification Level Classification E-value
Superfamily Spectrin repeat 2.55e-18
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 15 Region: 1906-2066
Classification Level Classification E-value
Superfamily Spectrin repeat 3.31e-18
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 16 Region: 1464-1593
Classification Level Classification E-value
Superfamily Plakin repeat 8.37e-17
Family Plakin repeat 0.0029
Further Details:      
 
Domain Number 17 Region: 4286-4399
Classification Level Classification E-value
Superfamily Spectrin repeat 1.04e-16
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 18 Region: 4724-4837
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-16
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 19 Region: 3579-3706
Classification Level Classification E-value
Superfamily Spectrin repeat 2.59e-16
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 20 Region: 3382-3521
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-16
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 21 Region: 656-787
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000176
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 22 Region: 2121-2244
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000227
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 23 Region: 4791-4913,4985-5015
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000232
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 24 Region: 3847-3962
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000201
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 25 Region: 5035-5145
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000109
Family Calmodulin-like 0.029
Further Details:      
 
Domain Number 26 Region: 2933-3091
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000164
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 27 Region: 2667-2768
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000209
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 28 Region: 2309-2443
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000023
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 29 Region: 1225-1326,1360-1384
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000317
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 30 Region: 1809-1916
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000158
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 31 Region: 1676-1797
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000173
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 32 Region: 2522-2644
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000158
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 33 Region: 1596-1707
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000464
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 34 Region: 1153-1255
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000082
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 35 Region: 594-688
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000301
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 36 Region: 994-1143
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000331
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 37 Region: 426-553
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000489
Family Spectrin repeat 0.0097
Further Details:      
 
Weak hits

Sequence:  FBpp0290808
Domain Number - Region: 872-926
Classification Level Classification E-value
Superfamily SH3-domain 0.000138
Family SH3-domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290808   Gene: FBgn0013733   Transcript: FBtr0301593
Sequence length 5458
Comment pep:known chromosome:BDGP5:2R:9751742:9798451:-1 gene:FBgn0013733 transcript:FBtr0301593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSSSQSTLKRTQQLVRQTNGGRGDVLSSGSEVVHSSRGPAITTNIDDSNLRYRHETKRE
RTVEAVITDYPGVSPLGSVPHERTNFERTVTFQDPTGNSRRLSETGALVPAGAIPTSSTH
YQQVTRNKRISTEVLGSSVESTKTSQRAPNGHRRVTTHIVRKVTTLSRAEENAQPAEDLL
PPAKMIRSSELEYRRALPPAIESSSTQRREISDIVVGKEDNVSAREALLRWARRSTARYP
GVRVNDFTSSWRDGLAFSALVHRNRPDLLDWRKARNDRPRERLETAFHIVEKEYGVTRLL
DPEDVDTNEPDEKSLITYISSLYDVFPEPPSIHPLFDMESQRRVHEYRDLAQQFIYWCRE
KTAYLQERSFPPTLIEMKRLLSDLQRFRSDEVSARKREKSKLIQIYKELERYFETVGEVD
VEAELRPDAIEKAWYRMNTALQDREVILQQEIERLERLQRLADKVQREIKHVDQKLTDLE
GRIGEEGRRIERLHPVDAKSIVEALETEIRHLEEPIQDMNQDCHVLNEGRYPHVSELHKK
VNKLHQRWAQLRTNFHTNLVQKLSGLKYPVHETTVTRQTRMVVESRQIDTNPHFRDLQEH
IEWCQNKLKQLLAADYGSDLPSVKEELDRQQHEHKIIDQFHTKILNDERQQTKFSGDELA
LYQQRLNQLQKVYAELLSTSTKRLSDLDSLQHFLGQASAELQWLNEKEQVEITRDWADKQ
LDLPSVHRYYENLMSELEKREMHFATILDRGEALLNQQHPASKCIEAHLTALQQQWAWLL
QLTLCLEVHLKHATEYHQFFGEIKDAEQWLAKRDEILNSKFSQSDFGLDQGETLLRGMQD
LREELNAFGETVATLQRRAQTVVPLNKRRQPVNRQGPVQAICAYKQQGQLQIEKGETVTL
LDNSGRVKWRVRTAKGQEGPIPGACLLLPPPDQEAIDAAERLKRLFDRSVALWQKKHLRL
RQNMIFATIRVVKGWDFDQFLAMGPEQRTAIRRALNDDADKLLSEGDPNDPQLRRLRREM
DEVNRLFDEFEKRARAEEESKQASRIFTEECLAIKSKLEDMARELDQIILAPLPRDLDSL
EHVLEIHSDYERRLHLLEPELKHLQETFRTIALKTPVLKKSLDNLMELWKELNTQSGLHK
DRLKLLEASLAGLEDNEHVISELENELARHQDLPSTAEGLQQVFKQLNHMQDIITQQQPQ
MDKMNDAADQLGRMGVPTKVLGDLKRLHSNVERLNTRWSAVCNQLGERMRSCETAIGLMK
NLQSSVQVEESWVDGTTERLSAMPTATSAYELDKLLGAAIERKPKIENVNVAGGRLIREA
KIYDSKCLRFVDWLVEARPSFSPPRRDLRPADSDPGATQYYSQRLDNLNTKNDRLLEQLS
QRLKTAIEVNGSDGLQYAESLQKPLKTFRVDFSAGSVPTGDGYAARQEDLYTTTYSTTQI
SSTKTTKSSTKSVYSSDGLDAASQEVSTAGLPQSQIQFNEIRTLKRSQQLGGHSVLDIAG
IRDPRTGRVLTIGEAIQLRILDVRTGEMLVGDRRITLEQAADQGLIDLQLAKQLLEPGAG
RDASGRELSLLEVIQREISEAESGYETAEKRIKQAVFEKFNMCEENVNDLLKWVTTVEQK
ISSVGGPREKIDELRNQINALKQIKDEIESQQRPVATCLEQIRQIVLTGGDVLSAPEVTT
LENSGRELRSRVDRVNDRTVRLLRRLEAGRDELTKLRSELDVFSDWLQVARRTLEDKERS
LSDLTRLPSQADSVREFVSDVIGHQADLRFITMAAQKFVDESKEFLAILNDFRTSLPERL
PHVEPLSSAESPIRQEVSLVSAQYKDLLNRVNALQDRVSGLGGRQREYQDALDKANEWLR
SVHPRVSRIISEPIAGDPKGVQDQMNEAKALHNELLSSGRLVDNAQQALDNLLRSLGGQL
SPMEINQLELPIADLKNNYQQLLDNLGEHCKTLDKTLVQSQGVQDALDSLVGWVNQAEDK
FKMNLRPASLIKERLQEQIREHKVLLADLQSHQASIDSVQVSAKHLLASASNARIAKKVE
SNLNDVTVKFEKLYEKANKRGEFLDDVYNRLSRYLDEISTVEQRMASLQEALDSRETSLL
STEELARRMNELSRDKDQLAPQFEDCVRSGKDLISLRDVTDTGVLRDRIKALESQWRNIN
ISIDERAKLSKQKAEQQLAYEGLKDQVLSWLASTEARVNGLPPVAIDLDRIKQQHDELKP
ICKDYRDYAPTIDKINDIGAQYDALIRPESPARKRSTYSPIKRTSPLRRMSGDARSPSPT
KGGILSPLSTGSSGFGSRRSSQDGFQLSELSPVQQQLSEINNRYGLIGVRLNDRQHELDN
LNEELRKQYENLKGLAQFLERIQRQLPKESVSNKDEAERCIKQARKILEDMYEKQSLLDT
TKAQVKDILRRKSDVPGAEQLRQENDSIQEKWKNLNDICKNRIAFSEKLRDFLDTHGNLK
SWLDSKERMLTVLGPISSDPRMVQSQVQQVQVLREEFRTQQPQLKHFQELGHDVVDHLAG
TPDAQAVEIKLKDILGKWDDLVGKLDDRANSLGGAADSSKEFDAAVNRLREALQNISDNL
DTLPTDGDHQENLRKIENLERQLEGQRPLLADVEQSAATLCNILGDPASRADVNSRVAAL
EKQYLALQKKLDTKKAETEASLRDGRHFAENCSKTLGWLGGELSNLTDRLLVSAHKPTLQ
HQIDTHEPIYREVMAREHEVIMLINKGKDLTDRQQDRGVKRDLDRIQQQWEKLRREAVDR
HTRLQTCMEHCKKYSQTSETFLAWLRTAEDKLADLTPGVLSKAKLETRLRDLQTFRSEVW
KHSGEFENTKGLGETFLSSCDIDKEPIKAELQDIRDRWERLNNDLIARAHEIENCSRRLD
DFNDELRNLDHSLGRCEDRLAAHDALGGAAKDPKLLERVKAIREELTNLSKPLQSLKALA
KDISAEARAAGGDADHLTSEVDGLADRMSELQGRLDDRCGELQSAATAVSQFNEQMKSLG
IDLNDLETEIEKLSPPGREIKIVQVQIDDVGKIQTKLDRLVGRLEDAERAADVLVDAGFA
ADTTQTREQISTLRKTLGRLDNRVRDHEDNLHSTLKALREFYDHQSQTLDDIQDVSDEFK
RMKPVGSELDQIRRQQEDFRNFRERKVEPLAINVDKVNVAGRDLVRSAGSGVSTTAIEKD
LEKLNDRWNDLKERMNERDRRLDVALLQSGKFQEALAGLSKWLSDTEEMVANQKPPSSDY
KVVKAQLQEQKFLKKMLLDRQNSMGSLANLGKEVANHCEPGERASIEKQLNDLMKRFDAL
TDGAEQRELDLEEAMEVAKRFHDKISPLELWLDNTERSVKAMELIPTDEEKIQQRIREHD
RLHDEILGKKPDFSDLADVTAQLMHLVSDEEAVNLGEKVRGVTERYTGLVDASDNIGALL
AESRQGLRHLVLSYQDLVAWMESMEAELKRFKSVPVYAEKLLEQMDHLLELNENIAGHAS
NVESTVESGAELMKHISNDEAIQLKDKLDSLQRRYGDLTNRGGDLLKSAQNALPLVQQFH
EAHNRLVEWMQSAEAALAPSEPRQADVLRLEGELADMRPILDSINQVGPQLCQLSPGEGA
ATIESIVTRDNRRFDSIVEQIQRKAERLHLSNQRAKEVTGDIDELLEWFREMDTTLREAD
LPAMEPKLVRAQLQEHRSINDDISSQKGRVRDVTAASKKVLRESPQSENTATLREKLDDL
KEIVDTVAQLCSERLGILEQALPLSEHFADSHQGLTAWLDDMEQQISRLSMPALRPDQIT
LQQDKNERLLQSIAEHKPLLDKLNKTGEALGALVADDDGAKINEILDTDNARYAALRLEL
RERQQALESALQESSQFSDKLEGMLRALANTVDQVNQLDPLSALPQKIREQIEDNDALMD
DLDKRQDAFSAVQRAANDVIAKAGNKADPAVRDIKAKLEKLNNLWNDVQNATKKRGSSLD
DILSVAEPFWKQLNSVMKTLKDLEETLSCQEPPAAQPQDIKKQQVALQEIRHEIDQTKPE
VEQVRRHGSNLMNMCGEPDKPEVKKHIEDLDNAWDNITALYAKREENLIDAMEKAMEFHE
TLQNLLKFLTKAEDKFAHLGAVGSDIDAVKRQIEQLKSFKDEVDPHMVEVEALNRQAVEL
TERTSPEQAASIREPLSVVNRRWEALLRGMVERQKQLEHALLHLGQFQHALNELLVWINK
TDSTLDQLKPIPGDPQLLEVELAKLKVLANDIQAHQNSVDTLNDAGRQLIETEKGSVEAS
TTQEKLRKLNNEWKQLLQKASDRQHELEEALREAHGYIAEVQDILGWLGDVDAVIGASKP
VGGLPETATEQLERFMEVYNELDENRPKVETIQAQGQEYIKRQNQMKVSSSNLQHTLRTL
KQRWDAVVSRASDKKIKLEIALKEATEFHDTLQAFVEWLTQAEKLLSNAEPVSRVLETIQ
AQMEEHKVLQKDVSTHREAMLLLDKKGTHLKYFSQKQDVILIKNLLVSVQHRWERVVSKA
AERTRALDHGYKEAREFNDAWSGMMQYLQETEQVLDQIIEEATASKEPQKIKKYIGKLKE
THRQLGAKQSVYDGTMRTGKNLLERAPKGDRPVLDKMLIELKEQWTRVWSKSIDRQRKLE
EALLLSGQFSDALGELLDWLKKAKSRLNENGPVHGDLETVQGLCEHHKHIEQDLQKRAAQ
MQGVLKTGRDLERSGNNPEVGRQLDEMQSIWEEVKSAVAKRGERLQVALVDAEKLNARVQ
ALFDWLDHAEHKLRYAKNAPDDEKVSREMMDIHMDFMKDLRVREREKTETFEYAEDIINK
AYPDAIPIIKNWLSIIQQRWEEVRQWAINRESKLEQHLQSLKDLDDTIEELLAWLSGLEG
TLLNLKHEQLPDEIPPVEKLIEDHKEFMENTARRQNEVDRACKPRQLPPGARKPSRSGKT
PVRGSSHDLREQSPDGTLRRQSFKGSRDQGLNARKGSRITPTRDTPDRDRLPHYGPRFSP
STSGPELEFRSPRAKLLWTKWRDVWMLSWERQRLLNDHLLYLKDVERARNFSWDDWRKRF
LKYMNHKKSRLTDLFRKMDKDNNGMIPRDVFIDGILNTKFDTSGLEMKAVADLFDRNGEG
LIDWQEFIAALRPDWQERKPANDSDKIHDEVKRLVMLCTCRQKFRVFQVGEGKYRFGDSQ
KLRLVRILRSTVMVRVGGGWVALDEFLQKNDPCRAKGRTNIELREQFILADGVSQSMAAF
TPRRSTPNAAATASSSPHAHNGGSSNLPPYMSGQGPIIKVRERSVRSIPMSRPSRSSLSA
STPDSLSDNEGSHGGPSGRYTPRKVTYTSTRTGLTPGGSRAGSKPNSRPLSRQGSKPPSR
HGSTLSLDSTDDHTPSRIPQRKPSTGSTASGTTPRPARLSVTTTTTPGSRLNGTSTITRK
TASGSASPAPTRRNISGSSTPSGMQTPRKSSAEPTFSSTMRRTSRGTTPTEKREPFRL
Download sequence
Identical sequences E1JH65
NP_001163150.1.81976 FBpp0290808 FBpp0290808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]