SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0305485 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0305485
Domain Number 1 Region: 333-427
Classification Level Classification E-value
Superfamily TAFH domain-like 9.29e-33
Family TAFH domain-like 0.00034
Further Details:      
 
Domain Number 2 Region: 752-801
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000000147
Family TBP-associated factors, TAFs 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0305485   Gene: FBgn0010280   Transcript: FBtr0333290
Sequence length 962
Comment pep:known chromosome:BDGP5:3L:16106312:16114468:1 gene:FBgn0010280 transcript:FBtr0333290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTSQTAAGNRITFTSQPLPNGTISIAGNPGAVISTAQLPNTTTIKTIQAGIGGQHQGLQ
QVHHVQQQQQSQQQQQQQQQTQSVGATQTQTLVIKSNHHAVTLPAGLVSSAPAGIVTMTK
TINQAGQPLLNSMLPAGVVVGMRQQAPSQQQQKNVPTNPLSRVVINSHMAGVRPQSPSIT
LSTLNTGQTPALLVKTDNGFQLLRVGTTTGPPTVTQTITNTSNNSNTTSTTNHPTTTQIR
LQTVPAAASMTNTTATSNIIVNSVASSGYANSSQPPHLTQLNAQAPQLPQITQIQTIPAQ
QSQQQQVNNVSSAGGTATAVSSTTAATTTQQGNTKEKCRKFLANLIELSTREPKPVEKNV
RTLIQELVNANVEPEEFCDRLERLLNASPQPCLIGFLKKSLPLLRQALYTKELVIEGIKP
PPQHVLGLAGLSQQLPKIQAQIRPIGPSQTTTIGQTQVRMITPNALGTPRPTIGHTTISK
QPPNIRLPTAPRLVNTGGIRTQIPSLQVPGQANIVQIRGPQHAQLQRTGSVQIRATTRPP
NSVPTANKLTAVKVGQTQIKAITPSLHPPSLAAISGGPPPTPTLSVLSTLNSASTTTLPI
PSLPTVHLPPEALRAREQMQNSLNHNSNHFDAKLVEIKAPSLHPPHMERINASLTPIGAK
TMARPPPAINKAIGKKKRDAMEMDAKLNTSSGGAASAANSFFQQSSMSSMYGDDDINDVA
AMGGVNLAEESQRILGCTENIGTQIRSCKDEVFLNLPSLQARIRAITSEAGLDEPSQDVA
VLISHACQERLKNIVEKLAVIAEHRIDVIKLDPRYEPAKDVRGQIKFLEELDKAEQKRHE
ELEREMLLRAAKSRSRVEDPEQAKMKARAKEMQRAEMEELRQRDANLTALQAIGPRKKLK
LDGETVSSGAGSSGGGVLSSSGSAPTTLRPRIKRVNLRDMLFYMEQEREFCRSSMLFKTY
LK
Download sequence
Identical sequences M9PFP3
NP_001261927.1.81976 FBpp0305485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]