SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0305903 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0305903
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily NTF2-like 5e-27
Family NTF2-like 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0305903   Gene: FBgn0031145   Transcript: FBtr0333761
Sequence length 89
Comment pep:known chromosome:BDGP5:X:20906496:20910044:1 gene:FBgn0031145 transcript:FBtr0333761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFEGHQIQGAPKILEKVQSLSFQKITRVITTVDSQPTFDGGVLINVLGRLQCDDDPPHA
FSQVFFLKANAGTFFVAHDIFRLNIHNSA
Download sequence
Identical sequences D0Z726
FBpp0305902 FBpp0305903 NP_001259748.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]