SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0070351 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070351
Domain Number 1 Region: 290-613
Classification Level Classification E-value
Superfamily TPR-like 2.09e-101
Family Tetratricopeptide repeat (TPR) 0.000000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070351   Gene: FBgn0023516   Transcript: FBtr0070367
Sequence length 614
Comment pep:known chromosome:BDGP5:X:1760865:1763094:-1 gene:FBgn0023516 transcript:FBtr0070367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQSGIWRSKPILWRIRFCAAIYFIIIRALCNTVTKPIASITADKQLRSISTSNTMSFRP
LVEGDCGGVNPLMQLGGQFTRDVAHKDEGYVQRHFERAARPEDQLINEFLGQVTAPPQSF
QMDTLLQEMRDINIHGNPQQQMHSQQAEQWGQDFARGLAPALPNKMIHMQAQQQDLQHAQ
EFFDEPLISSQNFRSLPPLRQPLMPIAAGQQQDPFFDSAMETIITDHLPQAPQGESLDDW
ISDYQRSTEQKEQTAANFNEKFWERLQDEWQKLADENEHPWLSEYNDNMDAYKEYEFAEG
NPMSDVENPFEKGKEYLSKGDIPSAVLCFEVAAKKQPERAEVWQLLGTSQTENEMDPQAI
AALKRAYDLQPDNQQVLMALAACYTNEGLQNNAVRMLCNWLTVHPKYQHLVAAHPELQAE
GTSLASSLIGPSKLRDLQQIYLEAVRQHPSEVDAEVQDALGVLYNLSGEFDKAVDCYQSA
LQVDPQNAKTWNRLGASLANGSRSVEAVEAYQQALQLQPGFIRVRYNVGVCCMNLKAYKE
AVEHLLTALTMQAHTNAARELPNAAMAATFRGQNQMSESIWSTLKMVISLMGRSDLQSYV
SDRNLAALNEAFKD
Download sequence
Identical sequences O46085
FBpp0070351 FBpp0070351 NP_726771.1.81976 7227.FBpp0070351 FBpp0070351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]