SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0070720 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070720
Domain Number 1 Region: 716-807
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.69e-23
Family Canonical RBD 0.0097
Further Details:      
 
Domain Number 2 Region: 200-617
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000114
Family HAT/Suf repeat 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070720   Gene: FBgn0014024   Transcript: FBtr0070752
Sequence length 941
Comment pep:known chromosome:BDGP5:X:5212961:5216743:-1 gene:FBgn0014024 transcript:FBtr0070752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDADKQLERQLEKELDEMPAEDLDDDAYDEYDLIVIPDQGKGSPQQGHSESPQQEEEHKS
EELRQRSRPTWPPSSAGGDMTTIELISSDDEPSVEETEGGNAAGRGRARNDSSSSSDDVG
VIEGSELESNSEVSSDSDSDSDNAGGGNQLERSYQELNALPSKKFAQMVSLIGIAFKLND
LEKIESSVLELQNLATVPAHVWLKYLKARLVVTQTDEERKAFEEQCAKALGYYYSIPLSE
YVVNYLVDQGNVQNHVLWAKLLADYDVERPDFGDKLRSLISTITDENEAAAFVEMLQKHC
VTWTCNVEQRQMIKSVVDKFKQHLDETTRGWDWSEQHKAHVYDVETLSLDDDLKNAVIRF
IFERSVAKFPIVDVLWLSYIEFIQFEGVTVPENEDENEVTAEMVAKRAKRLGKGFLRNTE
LDLANRGVRSHPSVQLNHRFLDLMERSDFELAEVDEEIRLILQRIVTDMDMTVELHLDYL
AYRIRNTNASDEQQVASLRAAFNHAWEELTVLYGDQADTRYEVLQLWAQVEYTQLGSPDN
GREIWRQIMGYPGSSIRGLLWLNFAQMESEYNGGHGTRDVLRKALSQPVLENGLMVQEFF
RRYERCYGTYESIAACQALDLPVEYVKPRSRIKPNSQSAYPRQQKLKPRQQQQQTNREPL
NREQRRRQAHEQQQQQQQQQKHGIKKSRTEPSGGATSPPSKVKGPANAEAKESNFKYSPN
MEINKIFVRNLHPACSKEELHELFSPFGTIKDVRLVHKLNKQFKGIAYVEFEKPGEAQRA
VAGRDGCLFKGMNISVAISNPPPRGTSAVKPSVAPKRRVPTSLIPTTLVRQEVAAKKLRL
LLPEPGDISSTSASVDVAIKREANGEEQKGDVQERDEQKGEEQKGEEQKGEEPKGEEQKG
DDQIGEEQSGVEQKGDEKKEEEMPAAVPKSNDDFRKLFLKD
Download sequence
Identical sequences A8JUY0 Q9W4D2
FBpp0070720 FBpp0089396 FBpp0111789 FBpp0070720 FBpp0089396 FBpp0111789 7227.FBpp0111789 NP_001096883.3.81976 NP_001096884.1.81976 NP_511047.2.81976 NP_996353.1.81976 FBpp0070720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]