SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0070729 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070729
Domain Number 1 Region: 13-261
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.51e-57
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.0012
Further Details:      
 
Domain Number 2 Region: 300-501,547-655
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.85e-37
Family Extended AAA-ATPase domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070729   Gene: FBgn0024332   Transcript: FBtr0070762
Sequence length 819
Comment pep:known chromosome:BDGP5:X:5217881:5220771:1 gene:FBgn0024332 transcript:FBtr0070762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHEGEQFIKDIQREYVDFLDDEEDQGIYAGHVKDMIAEKSKRLIVNVNDLKRKNPQRAL
GLLSNAADEQLAFGRALKEYASTVDPGYAKMHEDLFVGFEGCFGNRHVTPRSLTSIYLGN
MVCVEGIVTKVSLIRPKVVRSVHYCPNTRKVMERKYTDLTSFEAVPSGAAYPTKDEDGNL
LETEYGLSVYKDHQTLTIQEMPEKAPAGQLPRSVDIVCDDDLVDRCKPGDRVQIVGSYRC
LPGKRGGYTSGTFRTVLLANNISLLSKESNLDISREDIMLCKKLAKNNDIFELLSKSLAP
SIHGHAYVKQAILCLLLGGVEKILPNGTRLRGDINVLLIGDPSVAKSQLLRYVLNTAPRA
IPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDIDRTAIHEV
MEQGRVTISKAGIHASLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFVM
LDVIDSDVDQMISDHVVRMHRYRNPKEADGEPLSMGSSYADSLSFVSSSEEKKDTEVYEK
YDALLHGKSRQRHEKILSVEFMRKYIHIAKCMKPKLGEQACEAIANEYSRLRSQEAVETD
VARTQPITARTLETLIRLSTAHARARMSKSVTIDDAHAAIELVQFAYFKKVLDKDRPSKR
RRNSGSDAEDDNGEASSQRSPSRRSKRTRTATVGADSDEEDIEPPQPDAGDLTRRETRRS
LPARSVAMLMASPSSEEQSVATSTTEPAIISDARLGEFKNNLQRLFREAREQSLALARIT
TAINVGSQEPFTAGEIEAAVHRMTEDNQIMVADDIVFLI
Download sequence
Identical sequences Q9XYU1
FBpp0070729 FBpp0070729 7227.FBpp0070729 FR501 NP_511048.2.81976 FBpp0070729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]