SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0070861 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070861
Domain Number 1 Region: 343-457,522-761
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 1.02e-38
Family Tex N-terminal region-like 0.014
Further Details:      
 
Domain Number 2 Region: 781-936
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.59e-21
Family Tex RuvX-like domain-like 0.013
Further Details:      
 
Domain Number 3 Region: 950-1043
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00000000008
Family Tex HhH-containing domain-like 0.022
Further Details:      
 
Domain Number 4 Region: 1229-1287
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000448
Family Cold shock DNA-binding domain-like 0.0076
Further Details:      
 
Domain Number 5 Region: 1342-1421
Classification Level Classification E-value
Superfamily SH2 domain 0.00000701
Family SH2 domain 0.006
Further Details:      
 
Domain Number 6 Region: 1055-1141
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.0000156
Family Tex HhH-containing domain-like 0.0061
Further Details:      
 
Domain Number 7 Region: 1449-1525
Classification Level Classification E-value
Superfamily SH2 domain 0.0000387
Family SH2 domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070861   Gene: FBgn0028982   Transcript: FBtr0070896
Sequence length 1831
Comment pep:known chromosome:BDGP5:X:6161847:6169019:1 gene:FBgn0028982 transcript:FBtr0070896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEFLDSEAEESEEEEELDVNERKRLKKLKAAVSDSSEEEEDDEERLREELKDLIDDNPI
EEDDGSGYDSDGVGSGKKRKKHEDDDLDDRLEDDDYDLIEENLGVKVERRKRFKRLRRIH
DNESDGEEQHVDEGLVREQIAEQLFDENDESIGHRSERSHREADDYDDVDTESDADDFIV
DDNGRPIAEKKKKRRPIFTDASLQEGQDIFGVDFDYDDFSKYEEDDYEDDSEGDEYDEDL
GVGDDTRVKKKKALKKKVVKKTIFDIYEPSELKRGHFTDMDNEIRKTDIPERMQLREVPV
TPVPEGSDELDLEAEWIYKYAFCKHTVSEQEKPESREKMRKPPTTVNKIKQTLEFIRNQQ
LEVPFIAFYRKEYVKPELNIDDLWKVYYYDGIWCQLNERKRKLKVLFEKMRQFQLDTLCA
DTDQPVPDDVRLILDSDFERLADVQSMEELKDVHMYFLLNYSHELPRMQAEQRRKAIQER
REAKARRQAAAAENGDDAAEAIVVPEPEDDDDPELIDYQLKQASNSSPYAVFRKAGICGF
AKHFGLTPEQYAENLRDNYQRNEITQESIGPTELAKQYLSPRFMTTDEVIHAAKYVVARQ
LAQEPLLRKTMREVYFDRARINIRPTKNGMVLIDENSPVYSMKYVAKKPVSDLFGDQFIK
LMMAEEEKLLEITFLEEFEGNACANGTPGDYVEESKALYQLDQFAKHVQEWNKLRAECVQ
LALQKWVIPDLIKELRSTLHEEAQQFVLRSCTGKLYKWLKVAPYKPQLPPDFGYEEWSTL
RGIRVLGLAYDPDHSVAAFCAVTTVEGDISDYLRLPNILKRKNSYNLEEKAQKLADLRKL
SDFIKMKKPHIVVIGAESRDAQNIQADIKEILHELETSEQFPPIEVEIIDNELAKIYANS
KKGESDFKEYPPLLKQAASLARKMQDPLVEYSQLCDADDEILCLRYHPLQERVPREQLLE
QLSLQFINRTSEVGLDINLMVQNSRTINLLQYICGLGPRKGQALLKLLKQSNQRLENRTQ
LVTVCHLGPRVFINCSGFIKIDTSSLGDSTEAYVEVLDGSRVHPETYEWARKMAIDAMEY
DDEETNPAGALEEILESPERLKDLDLDAFAVELERQGFGSKSITLYDIRNELSCLYKDYR
TPYTKPSAEELFDMLTKETPDSFYVGKCVTAMVTGFTYRRPQGDQLDSANPVRLDSNESW
QCPFCHKDDFPELSEVWNHFDANACPGQPSGVRVRLENGLPGFIHIKNLSDRQVRNPEER
VRVSQMIHVRIIKIDIDRFSVECSSRTADLKDVNNEWRPRRDNYYDYVTEEQDNRKVSDA
KARALKRKIYARRVIAHPSFFNKSYAEVVAMLAEADQGEVALRPSSKSKDHLTATWKVAD
DIFQHIDVREEGKENDFSLGRSLWIGTEEFEDLDEIIARHIMPMALAARELIQYKYYKPN
MVTGDENERDVMEKLLREEKANDPKKIHYFFTASRAMPGKFLLSYLPKTKVRHEYVTVMP
EGYRFRGQIFDTVNSLLRWFKEHWLDPTATPASASASNLTPLHLMRPPPTISSSSQTSLG
PQAPYSVTGSVTGGTPRSGISSAVGGGGSSAYSITQSITGYGTSGSSAPGAGVSSSHYGS
SSTPSFGAINTPYTPSGQTPFMTPYTPHASQTPRYGHNVPSPSSQSSSSQRHHYGSSSGT
GSTPRYHDMGGGGGGGVGGGGGSNAYSMQPHHQQRAKENLDWQLANDAWARRRPQQHQSH
QSYHAQQQHHHSQQQPHMGMSMNMGITMSLGRGTGGGGGGGYGSTPVNDYSTGGGHNRGM
SSKASVRSTPRTNASPHSMNLGDATPLYDEN
Download sequence
Identical sequences N0D8I3 Q9W420
7227.FBpp0070861 FBpp0070861 FBpp0070861 FBpp0070861 NP_001284936.1.81976 NP_651962.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]