SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0070908 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070908
Domain Number 1 Region: 252-284,323-426,477-526
Classification Level Classification E-value
Superfamily TPR-like 2.05e-22
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 
Domain Number 2 Region: 65-132,161-200,255-297
Classification Level Classification E-value
Superfamily TPR-like 0.00000348
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070908   Gene: FBgn0029879   Transcript: FBtr0070947
Sequence length 615
Comment pep:known chromosome:BDGP5:X:6491216:6493732:1 gene:FBgn0029879 transcript:FBtr0070947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASFLIVVEKMEIALFANAKKLYDHKLYECVIPAADLLRTVLKNDRYVATLDVEYQVLLY
LLNANYKERNYRAALRHFDEIIHKRRLMMRHKNAVLVAIESSYPEFGDAEQRRRAAECYR
QIGNTDMAIETLLQVPPTLRSPRINLMLARLQHHGSRHGTTKKSEAVLAYKEVIRECPMA
LQVIEALLELGVNGNEINSLVMHAATVPDHFDWLSKWIKALAQMFNFKHSDASQTFLMLH
DNTTLRCNEHLMMALGKCLYYNGDYFQAEDIFSSTLCANPDNVEAIGLMAVLCGQEGGCE
QDSADMDYLFAKVSSEVKYTASHWFAHAQLLYDEGKFERGLNFVEKCLDSEPRNHEALIL
RGRLLIALERHTQAVCAFRTAQMVAPYRFEIYRGLFHSYLAQKRFKEANALCNWTIRLFQ
NSPRSFTMFGRTLFLFPDPRMRRTARKFAEKSLKINHIYTPAVNLIADICQVEGPTKAII
KLLEKHVIIFPKVNLLNHLGDIMRKQKEPVKAMEYYYKALRQDPKSKRTLRGLRLLAKSD
DESPVLDESDDIGMDNQQSINDLTTLCEATNAQGAEGAESVENSREASSSAAARSGQEED
VDEHDWIDVPDGMSY
Download sequence
Identical sequences Q9W3Y6
FBpp0070907 7227.FBpp0070907 NP_572329.3.81976 FBpp0070907 FBpp0070908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]