SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0070913 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070913
Domain Number 1 Region: 24-247
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.57e-56
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.00024
Further Details:      
 
Domain Number 2 Region: 347-657
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.49e-39
Family Extended AAA-ATPase domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070913   Gene: FBgn0025815   Transcript: FBtr0070952
Sequence length 817
Comment pep:known chromosome:BDGP5:X:6568422:6571205:1 gene:FBgn0025815 transcript:FBtr0070952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVADAQVGQLRVKDEVGIRAQKLFQDFLEEFKEDGEIKYTRPAASLESPDRCTLEVSFE
DVEKYDQNLATAIIEEYYHIYPFLCQSVSNYVKDRIGLKTQKDCYVAFTEVPTRHKVRDL
TTSKIGTLIRISGQVVRTHPVHPELVSGVFMCLDCQTEIRNVEQQFKFTNPTICRNPVCS
NRKRFMLDVEKSLFLDFQKIRIQETQAELPRGCIPRAVEIILRSELVETVQAGDRYDFTG
TLIVVPDVSVLAGVGTRAENSSRHKPGEGMDGVTGLKALGMRELNYRMAFLACSVQATTA
RFGGTDLPMSEVTAEDMKKQMTDAEWHKIYEMSKDRNLYQNLISSLFPSIYGNDEVKRGI
LLQQFGGVAKTTTEKTSLRGDINVCIVGDPSTAKSQFLKQVSDFSPRAIYTSGKASSAAG
LTAAVVRDEESFDFVIEAGALMLADNGICCIDEFDKMDQRDQVAIHEAMEQQTISIARAG
VRATLNARTSILAAANPINGRYDRSKSLQQNIQLSAPIMSRFDLFFILVDECNEVVDYAI
ARKIVDLHSNIEESVERAYTREEVLRYVTFARQFKPVISQEAGHMLVENYGHLRQRDTGT
SGRSTWRITVRQLESMIRLSEAMAKLECSNRVLERHVKEAFRLLNKSIIRVEQPDIHLDD
DEGLDMDDGIQHDIDMENNGAAANVDENNGMDTSASGAVQKKKFTLSFEDYKNLSTMLVL
HMRAEEARCEVEGNDTGIKRSNVVTWYLEQVADQIESEDELISRKNLIEKLIDRLIYHDQ
VIIPLKTSTLKPRIQVQKDFVEEDDPLLVVHPNYVVE
Download sequence
Identical sequences C6SUY3 Q9V461
FR592 FBpp0070913 NP_511065.1.81976 FBpp0070913 FBpp0070913 7227.FBpp0070913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]