SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0071085 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071085
Domain Number 1 Region: 6-90
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000377
Family Single strand DNA-binding domain, SSB 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071085   Gene: FBgn0029977   Transcript: FBtr0071133
Sequence length 486
Comment pep:known chromosome:BDGP5:X:7812550:7814164:-1 gene:FBgn0029977 transcript:FBtr0071133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRIKFQRLAEMRPTMTRFSTVALIVSKSSPNIFYDKMSGTERGVLSLTIRDSPNHLTN
CKCWGQRDCVDEYAAMLQIGHVVDIVGAKVMSIPFAAPGEQRYQPQATVSCALVVNEGSG
YVVRHDNDDFGQITILQQLLHQPIRPLGAVLKLADVRSGLGFPDKIITTNVNLLVVVAAV
RPVRQIKRKLQGPLSEVQELLQCLEVIVIDASYPEGMLLSVWQPDWIQRAQQWQPRRTVL
HLIDVRVSYSNFHRSLVLSHSNCTLICENPQAAGDDCRLLLAFAATVPLTTFSGCDQAEL
DNMPAVASIQAQMTVRQIYSRAEGELQDPSIHQFTAVLYGMVTKFDLDGLTSHVNRKCIA
CQQHIPRNLQDCASDACQQYFSLDNDEPRSISYFNINIHLSDQTGTLVEARLAGHPAERI
LGLRAEDFERLAEREKSELKWRFLLKYFEVRLMIKKPVGVRNHLVIVVVDMQAIPLEKLV
ANMVVF
Download sequence
Identical sequences Q9W3M9
FBpp0071085 FBpp0071085 7227.FBpp0071085 FBpp0071085 NP_572422.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]