SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0071879 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071879
Domain Number 1 Region: 460-673
Classification Level Classification E-value
Superfamily TPR-like 1.52e-17
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 
Domain Number 2 Region: 123-300
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000142
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 
Domain Number 3 Region: 310-448
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000673
Family Tetratricopeptide repeat (TPR) 0.0082
Further Details:      
 
Domain Number 4 Region: 650-735
Classification Level Classification E-value
Superfamily TPR-like 0.0000011
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071879   Gene: FBgn0034829   Transcript: FBtr0071969
Sequence length 922
Comment pep:known chromosome:BDGP5:2R:19046429:19049553:1 gene:FBgn0034829 transcript:FBtr0071969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKMLSTYIEEAMEFYAIGKGADFKAIIEKGIASCMTTYSTYDRELYKAYALLATYLSNH
AFKIIKSRPAFQAMAINCFDQLDSLRQQHDPHLQVTKGFLWMLSSSRAQDADALLISVLR
NHPKNILALIGRACLAYNRQDYIGALGYFKSVLLIQPQGMADVWVGIGHCFWKMGELEKA
QLSFQIALEHNGQCLNAALALALVKFEHNDEQSYQDGKMLLTAAYKENNKNPDLLSILAG
MYYADGNHKLVWSFAGNAIKFTANKHIESRNYFQIAKSYHATGQFESAKKYYLLSAKSAP
DGYILPLVGVAQMYLHEGELNRSKAFLESFLTSEPDEPVVMDLLAKIYLEYKCPEKIDKA
IEMLVKVVESASYHQNTNSWLNLAFAYEQKRLWAHGVNAYQKAIDIYLSQGHQIPIEWLN
NLASSQLMAKMPEKALNTLDDALSKCRVMNSDNKTTNLLSLQYNRGLVLEELHMFTLAAE
NYKSITKEYSSYHDCYLRLGVMAIQKNNHTQAIEHLKDILVEDNLNMTARTYMGDCFKGL
SLDKFATFNYNMILARQSKFTNTYVSMAMGNFCLEKLQNWIAEGNFRAARKQQEKALQCF
GKILDCNPKNLWAANGIGAVLSSCNNLSAGGAIFKQIIECGNKCIPAIINSAHIALVSGQ
YRLAIQTYERCLKDHLPKNRVDVMHCLAKALYDNGDARKAKMWLLKVRHLVPHDPFVIFN
LGLAIKKETEQALALPRPQLDELMGLDGLLKVAFKLFCHINLNHPKISVRVSAKYAEDCQ
NLMTELIAKKRQASESHAMEEDRVQLQKQRYRDHIEHQRQQELQREEEERVRRENLKIQR
KEVLERTRKIISAPLAPDVPKKSAGNGRAKKNQENGDGKAKKSGPPKKKTRKRAAGKEQE
DIEPLKKPKSKEFIDTDDDNSE
Download sequence
Identical sequences Q9W1T9
FBpp0071879 7227.FBpp0071879 FR728 FBpp0071879 FBpp0071879 NP_611764.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]