SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0072020 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0072020
Domain Number 1 Region: 171-295
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.1e-37
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000293
Further Details:      
 
Domain Number 2 Region: 77-169
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.6e-24
Family Cold shock DNA-binding domain-like 0.0000181
Further Details:      
 
Domain Number 3 Region: 29-79
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.00000000000314
Family ECR1 N-terminal domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072020   Gene: FBgn0034879   Transcript: FBtr0072111
Sequence length 298
Comment pep:known chromosome:BDGP5:2R:19442541:19443724:-1 gene:FBgn0034879 transcript:FBtr0072111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTNAAIDLALDRVDWRDLAAQTEEQPRVYTPGEVLMPEAGFMRGHGTFVEDENIKSSVA
GVIQKVNKLISVRPLKSRYVGEIGDVVVARVSEVQQKRWRVDTNSRLDSILLLSSVNLPG
GELRRRSAEDEQMMRRYLDEGDLISAEVQNIFEEGSLSLYTRSLKYGKLSQGILVKVFPA
LVKRRKMHFHNLPCGASVILGNNGYIWISPTKGQEEEGGEGGFAQNLNEHVPRADREVIA
RLRNSILALAKCKLMIYDTSIQYAYEESLRYEAHELLQQNAIYDIGQQTQARLRDADE
Download sequence
Identical sequences Q9W1M9
7227.FBpp0072020 FBpp0072020 NP_001286771.1.81976 NP_611807.1.81976 7291605___KOG3013 FBpp0072020 FBpp0072020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]