SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0072146 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0072146
Domain Number 1 Region: 75-190
Classification Level Classification E-value
Superfamily FKBP-like 1.47e-21
Family FKBP immunophilin/proline isomerase 0.00054
Further Details:      
 
Domain Number 2 Region: 221-360
Classification Level Classification E-value
Superfamily TPR-like 2.8e-16
Family Tetratricopeptide repeat (TPR) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072146   Gene: FBgn0003401   Transcript: FBtr0072237
Sequence length 455
Comment pep:known chromosome:BDGP5:2R:19728984:19730802:-1 gene:FBgn0003401 transcript:FBtr0072237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEENFEPYTPQLLKNPLSYSDLVKKGVEFEVDNSQQNHARDLGLDSDSDSDYEDALDVDG
EELRSPWTYSFDELRALMSEIDENIYKRITRTGHVDREAVPNKARVSVRYSGYWEGETAP
FDSSLLRGSKFVFETGQGTVVEGLEVAVRSMRPYEQAEFIISYKLLFGELGCPPRIKPKA
DALFKVEVIDYSLIGDAKGIDAIPQEDRDKFCVVYPKAVDLHLHGKDSVKLGRYQSAATA
FERAVSSLNYCRMANDEEERKQTELLTTLNQNLMIVYNKMNKPKRACIMMKALRHLTMGN
PSCKALFQEGRALAALGEYNLARNAYLQAQAKQPANKEISDEIISMNKRISKYEEASRDI
WARAFSLKNSKSDVRKTPAQLEKEAKEQDFNDKMEDLIRRFKNTSDQQVSFSRKSYSNAQ
FDATCKLAKEHNLKLTLSPIQEDVLTLSKPDVKFA
Download sequence
Identical sequences Q9W1I9
7227.FBpp0072146 NP_611837.1.81976 FBpp0072146 FBpp0072146 FBpp0072146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]