SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0072693 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0072693
Domain Number 1 Region: 5-168,200-319
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.13e-74
Family WD40-repeat 0.0001
Further Details:      
 
Domain Number 2 Region: 358-546
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000501
Family WD40-repeat 0.035
Further Details:      
 
Weak hits

Sequence:  FBpp0072693
Domain Number - Region: 1007-1042,1104-1156
Classification Level Classification E-value
Superfamily TPR-like 0.00195
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072693   Gene: FBgn0025725   Transcript: FBtr0072811
Sequence length 1234
Comment pep:known chromosome:BDGP5:3L:1641066:1645235:-1 gene:FBgn0025725 transcript:FBtr0072811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTNFESKSARVKGLSFHPKRPWILVSLHSGVIQLWDYRMHTLLEKFDEHDGPVRGVAFH
QQMPLFVSGGDDYKIKVWNYKQRRCIFTLLAHLDYVRTVAFHHEYPWILSASDDQTIRIW
NWQSRNCICVLTGHNHYVMCAQFHPTEDQIVSASLDQTVRVWDISGLRKKNVAPGPGGLD
DHLKGHPGATDLFGQADAVVKHVLEGHDRGVNWASFHPTLPLIVSGADDRLVKLWRMNEY
KAWEVDTCRGHYNNVSSVLFHPRQDLILSNGEDRSIRVWDMTKRQCLFTFRRDNERFWIL
TAHPTLNLFAAGHDGGMVVFKLERERPAYAVHGNILYYVKERFLRKLDFTTTKDTVVMQL
RPGKSPVYSMSYNPALNAVLICTRTNNLENSTYDLCQIPKDTESQSESDSKRSSGITAIW
VARNRFAVLDRNQQLVIKNFKNEVTKKLPTFCEEIFYAGTGMLLIRDPEFVTLYEVQRLV
SVGSIKLAKCRYVVWSPDMSLVALLCKHSVTICDRRLQYLCTVQENCRVKSGAWDESGVF
IYTTSNHIKYAITNGDHGIIRTLDLPIYLTRVKGNQVFCLDRECRTRVLHIDPTEYKFKL
ALIQRKYDEVLHMVRNARLVGQSIIAYLQQKGYPEVALHFVKDEKTRFGLALECGNIEIA
LEAAKALDDKDCWDRLGQSALLQGNHQVVEMCYQRTKNFDKLSFLYLITGNLEKLKKMNK
IAEIRKDVSAQYQGALLLGDVKERVNILKNCGQLSLAYLTAATHGFDELTESLGESITSQ
GNSLPEVNPNAQLLQPPVPIQQLETNWPLLSVSKGFFEGAMVTRAGSSATARQALNINAD
AALLDEHNGGGDGWGADADLGLDEDGDDEMHDALSNDGDGGAGGEEGAGWDVGDDDLVVP
EELASKIKASALDSNYYAAPNKGLSPAQQWANNSPLVLDHVKAGSFETAFRLLHDQLGVV
NFQPFKTLFLQNYACSRTSYTANPNLQSLSGYPLRNYSETNIKLQRPAVGIKLNDLVARL
QAGYQLTTSGKFSEAVEKFHSILISIPLLVVDTKLDAAEAQQLLRICAEYIVGLKMETVR
KGMPKSTLEEQKRLCEMAAYFTHCKLQPVHQILTLRTALNMFFKLKNYKTAASFARRLLE
LAPRPDVAQQVRKILQACEVNPVDEHQLQYEEFNPFTICGISWKPLYRGKPEVTCPFCSS
SFDPQFKGNLCTVCEVSQIGKDSIGLRISNLQFR
Download sequence
Identical sequences Q9W0B8
FBpp0072693 FBpp0072694 FBpp0072693 7227.FBpp0072693 FBpp0072693 FBpp0072694 NP_477395.1.81976 NP_728648.1.81976 7292122___KOG0292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]