SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0072752 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0072752
Domain Number 1 Region: 17-330
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.73e-33
Family WD40-repeat 0.016
Further Details:      
 
Domain Number 2 Region: 263-332,441-571
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000201
Family WD40-repeat 0.032
Further Details:      
 
Weak hits

Sequence:  FBpp0072752
Domain Number - Region: 624-677,711-801
Classification Level Classification E-value
Superfamily TPR-like 0.00872
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072752   Gene: FBgn0035317   Transcript: FBtr0072873
Sequence length 1772
Comment pep:known chromosome:BDGP5:3L:2229646:2235253:1 gene:FBgn0035317 transcript:FBtr0072873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLKYLRTLLEGQEQIQRIAGLAWSPNQQRLAIATADRHILLYDDAGERRDKFSTKPANP
ANGKNSYVIRGLAFSPDSTKLAVGQSDSIVYVYKLGESWNDKKVICNKFPQASAVTALIW
LTSGSIIAGKSPFPNEMNIFHQVFTTGLEDGKVRALHSKSNKSQSLYGGDSICISLAANT
KGTGFLSGHNDGTIIRYFMTDEATEPLGRVVQHPVPPFALAWPQGGFCAGGCDQRIVFYD
SMGRQLRTFDHSRTEGEREFTVAACSPNGQAVAFGSFDRIRIFAWSPRQGAWSESATKEV
ACLYTLSSLLWRRDGARLALGSVSGAVLLFESVLRRTVWQDKFELIFVAPSQLLVRSLTE
PSQALTIESQLGLEIDDVRIMGRDNYLVARTEESLILCDLTRNLSSEVPWTASGHHERFY
FENPTVCLIFNVGELSLVEYGENSILGSVRTEFVNPHVISVRLNERGNAKENKKLAFLLD
AKTICVVDLISRMTSGQISHETKIDWLELSETAHKLLFRDKKLRLILVDNYTGKKQTLLS
NISFVQWVPQSDVVVAQSNSNLAIWYNIDLPEHVTMQSVRGEAIEVLRENGRTVVRSQDG
PSEHNYQLDEGLVEFGTAVNDSDFGRAVHFLESLGDKPAAKAMWHNLALIALEDGNLRVA
QRCYAALGNVSKAYYLAGMIQQADEFEESSGSPGILCPEVRAKLALLGSDLRTAERIYLE
QGDIESALKMYQQLGMWDEAVALAERRGYNRIAELKQQHMDYLLSSEQQEKAGQVLEEQG
DLQQAMSLYMKANKPARAARLALKTPHILQDEQVMLQVTEGLVRSELYELAGDIAHRLSR
PEAALALYRKGGAYARALEIGRVVAPQEVTALEEEWGDWLVSRKQLDASINHYIEAGATQ
KALEAAVGAKQWRKAVQIAKVLDEPELIQRYAVDLAKHLAFAGDLDGAEDMLVRANLHKD
AIELLNRHGKWERAYLIGEKHLKAEQVRELFVQLAGTLEEQGKFRDAEKVLIAVNEPDLA
IAMYKRRELYDSMIRLVERYHKDLLDSTHLHLARQLESRGKLKNAEMHFVASGDWKSAVH
MYCSSGRWEDGYRVAKLKGTEGASQQVAYMWAKSMPTEGAVRLLSKLGLLDTAVGFACDS
GQFEFAMELCKFAGKPTDEVHLKIAMSLEDEGKFEAAEAEFLKANKPREAILMYQHAGDW
QAALNVAENHLPDAVGEVLIGQASAALETSNYKDYEALLLRAHRPDLIIEHYKQESLYED
ALRIAEEHYPSALNDLRRLQAQLQRGQAQAQAGEDAASISRSYLQKAAEFAKKEQFRKAA
ECLMQIDSSNAEDASTLERALLRAAEICNQFLEGQDAQELAQSLGPRLLAIKQIGPAAQL
YLAADMPKQAVDVFIKTEQWSKARRLAKEIDPDLQLLAYVEQQQKASLKHEGNIEQLADI
DIVSALDLLAEHGEWQRCLEKAKGLNPALLQKYVAVYAAQLIREGNCTTALGLYLSYGAP
PIEAHFNIYTRIALDCLALREEQTERGTTWRQLRDFLFRLLQSLKATPAQSQTKFAASME
QFLLIAHYYATRAACKEVQALQPVALRLSLALLRHTDLLPVDKGFYEAGMDLRQAGREAE
AFVMLNHYLDVCEAIEEGSGQLVDHSDLASTDFPSSVPLPEDIHLKNDPSLHEEVREWVL
AVSMDQQVDQQLPTDDRGLYESSLGPNDLPCMLSGFPVRGRQPVTFQGSSNQVNRDVWSK
FSVALKMSPGSGIADIISFTEKWQGAANYVMH
Download sequence
Identical sequences FBpp0072752 FBpp0072752 7227.FBpp0072752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]