SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073017 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073017
Domain Number 1 Region: 24-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000076
Family Ubiquitin-related 0.019
Further Details:      
 
Weak hits

Sequence:  FBpp0073017
Domain Number - Region: 81-115,144-172
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.068
Family LacY-like proton/sugar symporter 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073017   Gene: FBgn0035471   Transcript: FBtr0073159
Sequence length 302
Comment pep:known chromosome:BDGP5:3L:3903511:3905033:1 gene:FBgn0035471 transcript:FBtr0073159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELEILNAKNSKPYGKVKVPSGATPIGDLRALIHKTLKQTPHANRQSLRLELKGKSLKDT
DTLESLSLRSGDKIYVKDLGPQIGWKTVFLAEYAGPLIVYLIFYFRPELVYGKAASLPIS
LTTHIAAGCYTVHYVKRLLETIFVHRFSHATMPLRNLFKNCTYYWGFTAYVSYHVNHPQF
TSPCMCTVWGALGAFALCELGNFSVHIALRNLRPPGTKVRKIPVADGNPLTKLFDLVSCP
NYTYEIGAWVSFSVLTSCLAAYLFAFAGAFQMTIWALAKHRNYKKEFKDYPRQRRSIFPF
VL
Download sequence
Identical sequences Q9VZL3
7227.FBpp0073017 FBpp0073017 FBpp0073017 NP_647836.2.81976 FBpp0073017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]