SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0073411 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073411
Domain Number 1 Region: 165-289
Classification Level Classification E-value
Superfamily TPR-like 1.9e-22
Family Tetratricopeptide repeat (TPR) 0.001
Further Details:      
 
Domain Number 2 Region: 10-91,124-149
Classification Level Classification E-value
Superfamily FKBP-like 3.14e-16
Family FKBP immunophilin/proline isomerase 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073411   Gene: FBgn0030345   Transcript: FBtr0073567
Sequence length 320
Comment pep:known chromosome:BDGP5:X:11763221:11765201:1 gene:FBgn0030345 transcript:FBtr0073567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSRSKSDMKPIRKEILNPGNAYIELTPGTRVKFHFQTRRAGDSRIIDDSRKMEKPMELV
LGKKFKLEVWELIVQQMSLNEVAKFTVHKSLCAQYPFISKTLRDIGKKPEERRHCCGMTL
QNEGIGYTDLDELLQNPSDLEFIIELFSIELPEQYEKERWQMSDDEKMLATSTLRERGNN
FYKASRFTEAETCYREAVGIVEQLMLKEKPHDEEWQELAAIKTPLLLNYAQCRLIAGDFY
AVIEHCNEVLTLDPRNVKALFRRAKAHAGAWNPAQARRDFLDALALDASLKSTVSKELKS
IEDQQQARNVQDRIHMQKLF
Download sequence
Identical sequences Q9VYT2
FR722 FBpp0073411 FBpp0073411 NP_572758.1.81976 FBpp0073411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]