SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0073955 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073955
Domain Number 1 Region: 202-283
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000082
Family SAM (sterile alpha motif) domain 0.019
Further Details:      
 
Weak hits

Sequence:  FBpp0073955
Domain Number - Region: 102-208
Classification Level Classification E-value
Superfamily EF-hand 0.000102
Family Calmodulin-like 0.031
Further Details:      
 
Domain Number - Region: 439-545
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.00863
Family DNA repair protein MutS, domain III 0.048
Further Details:      
 
Domain Number - Region: 199-443
Classification Level Classification E-value
Superfamily TPR-like 0.0493
Family HAT/Suf repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073955   Gene: FBgn0045073   Transcript: FBtr0074159
Sequence length 570
Comment pep:known chromosome:BDGP5:X:15828934:15834543:-1 gene:FBgn0045073 transcript:FBtr0074159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKNTIWNYSLIFFCCVLKSISTLDHGPHTVSVDSNRHNTQHQYKQNPNVASQRHSSHES
GQSLHNSQSEHVTHIAASHAGSGGEHSTHLAQNLHRSSYNLLSEAMSQAVSNEFSSMGSG
SADGACAADDFDCYSGSVQDRFGMEAIASLHRQLDDDDNGNIDLSESDDFLREELKYDSG
YEKRQKAFHFNDDMHISVKELWEAWLRSEVHNWTIEQTTDWLAQSVQLPQYVDLFKLHKV
TGAALPRLAVNNLQYVGNVLGIKDPIHKQKISLKAMDVVLFGPPRETGTRWKDYILVTLL
LSAIIGCWYAYQQNKNAKRHLRRMAQDMEGLQRAEQSLQEMQKELERARMEQENVATEKL
DLERRLKEAPTLSSSNSDLEVQQLKKEIEMLRNELSRAEFELVDNCWSPPPQLQSWLQYT
YELESKNHQKKRTSAEKQLQSAREACEKLRKKRSSLVGAFVSTHGKSIDDVDRSIVEARN
ALGDVTNELQERLHRWKQIETCLGLNIVNNNGLPYLENVLYGRNGGLQSSMGMSSTKGSR
ARITNSTEDLDDESIQGKLNFENFSLLATE
Download sequence
Identical sequences P83094
FBpp0073955 7227.FBpp0073955 FBpp0073955 NP_523357.2.81976 FBpp0073955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]