SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0074211 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0074211
Domain Number - Region: 406-442,484-510
Classification Level Classification E-value
Superfamily TPR-like 0.0043
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074211   Gene: FBgn0030840   Transcript: FBtr0074437
Sequence length 538
Comment pep:known chromosome:BDGP5:X:17340381:17342807:-1 gene:FBgn0030840 transcript:FBtr0074437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWTSGLYKSLLLRSQQSLVRPDLALLDIQISKRAIETMFGHRRELSFNHSHTADIIAKK
CEELFNANEFENALTTLYTDGRPFGGQFAHGRFEMIKQRSLAVFEDTLGESLRPFMHQHR
DVLEQINRRQKELAAHVSRPLWKKLRDQQQCDVQSIIIKERPQLTLLEKARRRASESLYN
HNYLGRSAVDIALLRQLRSDRNFLDPLRLATTPPMRKLTRRQFTIVRRLMKMLQARNPLY
NRRYVQQRHGPIADQERRRWQEMHLFHAQYQTRRDCMRMLHEVHKRRREGDVEKLSDYVE
NIMSGFIEYKTHRTLPWKFEFINEVYNILALAYCDKCAVPANVDFLQAQNRPILYLLRTE
KLHDMSVQFGGPNIYVEIEKEDERHSRISQKLEQLENRLRHSRFAIERSYLLFEIARCHF
QESRFDKCLVVARKAFNEARSCNCLIWRFNSIFLGCQVHAVLNRFERLKESLAKASQLAS
ELQAPKLVAYIAICINVNNYDLALQRIRQSDGNKRKSRKRSPVSTITSNSSQGSMSST
Download sequence
Identical sequences Q9VX50
FBpp0074211 FBpp0074211 FBpp0074211 7227.FBpp0074211 NP_573216.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]