SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0074480 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0074480
Domain Number 1 Region: 23-260,380-447
Classification Level Classification E-value
Superfamily TPR-like 1.88e-18
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 
Weak hits

Sequence:  FBpp0074480
Domain Number - Region: 658-714,752-789
Classification Level Classification E-value
Superfamily TPR-like 0.0467
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074480   Gene: FBgn0031020   Transcript: FBtr0074711
Sequence length 890
Comment pep:known chromosome:BDGP5:X:19374186:19378676:1 gene:FBgn0031020 transcript:FBtr0074711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSSDPLPPKEGALFRKLLKCYELKQYKNGLKLAKQILSNPKYMEHGETLAMKGLTLNGL
GRREEAYKYVRLGLRNDLRSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWEKDNLQILKD
LSLLQIQMRDLEGYKETRHHLFTLRPSQHASWIGFAMSYHLLGDYDMANSILETFSQSQT
SIEAHDYRHSELLLYQNQILIESNRLQQAVDHLTKYQGQIVDKLAVRETMGDLYIKLQQQ
EKAVPIFESLIRRNPENVLYYEQYIAARQVTDSSAVVSIYRVFQEQYPRALCPRRLPLNI
ANGDEFRVVTDEYLRRGLRKGIPPLFVNVRTLHQIPERAAVIEELALQYFENLTRSGHFS
REDADAGIPVEPASALVWTALFLAQHYDYMRDTDRALEYINVAIDHTPTLIELLITKGRI
FKHAGDPVEAYVWLEEAQSMDTADRYINSKCAKYMLRANMVQEAEEICAKFTREGVSAMD
NLNEMQCMWFQTECALAYQRMGRWGESLKKCHEVERHFAEIVEDQFDFHTYCMRKMTLRA
YVGLLRLEDVLRQHPFYFKAAKCAIEVYIRLYDKPLKSETTIEEIDIENLPPSELKKLRS
KQRKAKKKAELESAQAAQAQVKREQHQKSKQQANQETDPDAPQLDELVAEKLERTDDPLD
KAIEFLKPLQQLAKERIETHLLAFELYYRKNKLLLMLQCIRRARAVDASHPVIHSCIIRF
VKSLTSAAKEQPFNEHVQQVLEKATKELIGSKTPQQLNDEFIAKHNASILHLYEGARSLY
ELDNSKKAAAIKLVTSFNLAKLRLEEATKIYTALRDGDVFGECEAEAASYQQACHQRFQY
ARIFRNVEELEAQLQEKEAAKLRAEEEQQQLIHVDSSEPVSVLATAAAAS
Download sequence
Identical sequences Q9VWI2
FBpp0074480 FBpp0074480 NP_001285439.1.81976 NP_573384.1.81976 FBpp0074480 7227.FBpp0074480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]