SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0074734 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0074734
Domain Number - Region: 431-523,571-625
Classification Level Classification E-value
Superfamily TPR-like 0.00141
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074734   Gene: FBgn0260655   Transcript: FBtr0074966
Sequence length 1319
Comment pep:known chromosome:BDGP5:3L:19606780:19611617:-1 gene:FBgn0260655 transcript:FBtr0074966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHLTGQSYNARDIIRNIFSPLIGVLSSPQADEICHRNNLSFVELLQPFAKLPNDAHFRD
VSGTSVSVRGLRLNFCDVDWRPPQTILARKMLNESVTNAHNDKTRLATIAGIDLELPTSE
PWFEQWRETFLTVQFPADHEFTRHLLSCLLVLSSADPQIVETAHKLGQRVQQMQSITPQK
LPKWFHPTEVLNSYVVLHEASQGDLSKAQQGFELLKSTFGDSKCFLVSINSMDSQGAAEV
PDHWATFIKRQPKSDPNLPSTDLSAPKSPQEAVSVISMPAMQMSQLLEGVSAQDSDLAML
HPLSPMQESATEAINSKFSISSESIASQTINPNVWGNELEADAPHGGCLTSRDIDNLRHF
VQDYAVRALIPYIEHLVAILAEGVTNKKGVSKSLLSATKRWFVTSKPGAGANNQNAVIYT
NESAELQTRKLGDLYFMFGHYNLAFQSYHQAKRDFNADSAWQYYAGALEMAALSAFMLGT
AQRKTYDYMEDAIVCYLTVCKLQQFATRATLLSMECLKTARLYSEVAKQLIRMTNEESDL
RSALLLEQAAYCFLVTQPPMHRKYAFHIVLAGNRYSRAGQRKHAYRCYRQAYQVFQKREW
SLAEDHIQYTVAKQAYMLKQLEEASRSFAHLLRPGSLQSAQQQTSFLKEYIQTQNELVKR
SPELGLLPHALPQVVQSSVRVLTLVQSPSAVAPHVPATNIDINSNLTADEPIWNKIEEML
VITAANNKPFVFKPSRYLYTKQQPALETPVAVQGEPIELAVTLSNSVQCRIALSEIDLLW
KLTLDNDEVLSNACTYEESSDSANKIAVGAAIKTSCMASIKLAEQAEETLHFKLTPKLTG
RLSILGVVCRVAAGADPAASLLGTLQFETQKIRPHNAKQSSQTVMDNRLTIKLVPQLPAM
NVSFTPVPNRLLAGEIVPVHVTLRNMGIAPIEEIYLGCDNPRCVSLLDQHSQMPLAMMSS
LRNLSNDKLVKDKEIRGQRVYRLLNRPGLAALDAQQVQTISLWVQAPHQAGPFTLRLLFY
YSLPTVANSPIKYRLVRHIWQLQVESCLQADSTCVVSNAVTNELGLDVNVRNQHAVEGTE
VYINSISLYSTEFKLNPDRLHIMNSMGVSPGQAGAQCLKSSICCNFQCRLLEKETQEEYK
DIPSIKTLLHSRLSHLKILPAQHAQQVEQHMPPIHDPHSFLTNEETVYFNTNISTEEFNA
SVADYVPHATLVLSWSALVAREEGQRLACGLHFIKLYKLFETGHCPAAPTASFLRRRHSS
DDTLDNRREFPLPEGALNNEDAWQPLADADEEDYWEPNENYVGQRCLLEDESFVMAVKA
Download sequence
Identical sequences Q9VW22
FBpp0074734 FBpp0306028 FBpp0074734 FBpp0074734 NP_001262058.1.81976 NP_649135.2.81976 7227.FBpp0074734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]