SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0074841 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0074841
Domain Number 1 Region: 384-464
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000212
Family PCI domain (PINT motif) 0.046
Further Details:      
 
Weak hits

Sequence:  FBpp0074841
Domain Number - Region: 190-231,274-358
Classification Level Classification E-value
Superfamily TPR-like 0.00209
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074841   Gene: FBgn0027057   Transcript: FBtr0075074
Sequence length 525
Comment pep:known chromosome:BDGP5:3L:18896053:18898117:-1 gene:FBgn0027057 transcript:FBtr0075074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVLPMPPLMQNAVEPMQVDIAPPNEDNENNEEQQIVVENPSIDLEVYANQYAGIVRLHR
LIYVADVCPVLAVEALKMAITYVQTTYNVNLYQVLHKRLSDLNAGNAPAPPANAGGDQAG
AAAPGPLAAAPLPDIAAQPVAQAQGQAQPAVEKDAFAYDAAWVDTKMKKAALKLEKLDSD
LKNYKSNSIKESIRRGHDDLADHYLSCGDLTNALKCYSRARDYCTSGKHVVNMCLNVIKV
SIYLQNWAHVMSYISKAESTPDFAEGSKEANAQVHTRLECAAGLAELQQKKYKVAAKHFL
NANFDHCDFPEMISTSNVAVYGGLCALATFDRQELKRLVIASTSFKLFLELEPQLRDIIF
KFYESKYASCLTLLDEIRDNLLVDMYIAPHVTTLYTKIRNRALIQYFSPYMSADMHKMAM
AFNSSVGDLENEVMQLILDGQIQARIDSHNKILFAKEADQRNSTFERALIMGKQYQRHTR
MLVLRAAMLKSHIHVKSISREGGSNHGAELCVSAGSSTTAQLARI
Download sequence
Identical sequences Q9VVU5
FBpp0074841 7227.FBpp0074841 FBpp0074841 FBpp0074841 NP_524152.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]