SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0075422 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0075422
Domain Number - Region: 48-197
Classification Level Classification E-value
Superfamily TPR-like 0.0184
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075422   Gene: FBgn0036465   Transcript: FBtr0075669
Sequence length 262
Comment pep:known chromosome:BDGP5:3L:15034726:15035670:-1 gene:FBgn0036465 transcript:FBtr0075669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNLYTELKNEWSKHAPNLTHCSRLLDGFKLELVRSNFGTIQTASSSKQKDQLIKSREML
EIAVEHSITIKDYAAFERYMAQLNTYYYDYDKYLESSKHMYKFMGLNLLYMLATNRLADF
HIELERLPTALLLHDSFIQPVLALENYYMEGRYNKILQAKKSMPSEIYSNFMDILVNTAR
EEIASCMEKSYLKMAPKLAAQRLGLRPGSKELFELATKRQWCLDEEGNYDYAGLHTRPME
KVPAKDIATHNLTYAQELEKIV
Download sequence
Identical sequences Q9VUJ4
7227.FBpp0075422 FBpp0075422 FBpp0075422 FBpp0075422 FR100 NP_996086.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]