SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0075442 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075442
Domain Number 1 Region: 798-1240
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.65e-55
Family Tandem AAA-ATPase domain 0.078
Further Details:      
 
Domain Number 2 Region: 8-122
Classification Level Classification E-value
Superfamily TPR-like 0.0000209
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 
Weak hits

Sequence:  FBpp0075442
Domain Number - Region: 329-358
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000726
Family CCCH zinc finger 0.0026
Further Details:      
 
Domain Number - Region: 277-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000927
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075442   Gene: FBgn0036451   Transcript: FBtr0075692
Sequence length 2103
Comment pep:known chromosome:BDGP5:3L:14785231:14792466:1 gene:FBgn0036451 transcript:FBtr0075692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEKEMQAHDMVRRRSWARAVALYDQLIAPSPGQGSGGQSAGSRAQKDQQIACLLGRCE
CLLELGKFEGCLADAYKVLTLLSEQTECLASVSRARRWLVHALFKMHKYGDAEIFLSKWI
NELSGQQIYSDISKTLERYKSIIQMIMNGQHKAQALKIPHARLEDEMAILDTKLDHWATN
NLPLDKYSKLLSNKGLKKREQQQQQQQQQQQQNGNGIGSYASSSSSSSTGSSSTMSSSST
SLHKTNDLLAAMKLTAGKHQPGSGDGSGSDQGDQAAPSTTCSYCTITFQTRNELRQHCQT
EAHQKVIMSDEGRDWKWRPPPRGYTLDTYSLCETFSEAHICHYGAQCVEAHGQDELNEWK
ERFEYRRMRMQKACEKELYGKSYTEQVLDRWIQATAPERVMCERVPDMEARCEQQLVTSI
SSKTSKREWLFQLETKKPLKAVALLQDAHRNHFALKSIKMCKPTESSMELKSDQEWLAGS
SSQSETSNEDSATLIHEITVEFHTEIYGTFRQAICFDVGQEPLLVRHLCVDVLPVNDAEK
IEEIKRDIINSSATRWDVANTQLTRFETTIGTHLKTEAYLSDLEHERELLERYPCPRAAT
FTLTQSTIVEKRLTQNNYRSRIHELLSVEEIARYEQIARYNVRTRLTVASNYILTPAGMA
TSTAKYSLAGELFALMRLGKDISEDTSPGRLILSNCSSVYISKPEDPDSKADPTKRAVYE
ALIEDKGKNVIYLKLSAKCVEAMALQADTELEVDIQFQLNRMPYCEWHNAVDKITDFRLI
FPATELEPSIPWTPKKQWADSCEPKLNAKQREAVNAITTALSIKLPPILLIGPFGTGKTY
TLAQAIKQLLTQPEAKILICTHSNSAADLYIKEYLHPWIEEGLKEATPLRVYYHKRWSAT
VNGVVQKYCITDGVGNFLRPTVEDIMRHRIVVVTLSISMELATLGLPKGLFTHIFLDEAA
QAMECEAIMPLALANDSTRIVLAGDHMQMSPELFSAFAKERKLHISLLERLYDHYPSNFP
CKILLCENYRAHEAIIRFTSELFYEQKLVASGKQPRHDRFYPLTFFTTRGEDVQDKNSTA
FYNNAEVYEVVERVSELRKRWPSAWGKLNDTSIGIMTPYSDQVFRIRSELRKRRMGGISV
ERVLNVQGKQFRAVFLSTVRTRRTCMPQGSAPGSASTTSIGDADADYGFLSNSKLLNTAI
TRAQSLVAVVGDPVALCSIGRCRKVWERFIEICDEHKSLFGLTWSNLRSQLDGVELKRGY
VLNPLAPEFVPRALQPEAYLREQAALYLNGPQHGHGGHGPPGPPAHFANAAGMLGPGPAA
AAHQMNQMAAAMAANQQQLTAHMYSTHMAMMAAAVGGKSGNGPGPGTGGGPGPGPGPPPH
YGGGGGGGGHMGMRGPPPPAPHLRGMPPGGPPPTQQPGGAGGGGGPPPPYGQYPAMQHWR
PPQQGQNQGPGQQPPQNPNASLWGPPPQTNPWSVLPPSKQPQQPQPPPVSAPGRGPGPLP
PPLNANPSLPLRGGSVPPPPPNASTAAHLLRNPSELGYLAKKSLYNHGQALPHHQLYGPG
PGPPPPPSQQQPQAPPMGMQRGSSVPNGPMSPMENGPPPPPYLRHNGSGYNPGAPPPPPQ
QQPQPPPNPFMYAGKQPSPSSMRFGPMTHELLPPNVSIYDMAFNPKDEQYKWYVKLLETV
GQDGANKFAEMLRQVMATMQQQQQQHKPPQPPMANNPMLNNPHVQRPQYPMMYPQGQQQQ
QQQPPQQSVDASPPLENFNQQIDLVFNSIMNGANDVAQPILRDVLGMVAGTGNAPGPPLS
NGLNGVDLQQQQQQQQQQQQSRLFAMMQQQQQQQQQQQAKPPLGPGPLYPNHLGGPGLHQ
APPNGGGNLSGVGNTNFMGNAGNALLNDKPYNNVGMHNNVGLNIGGAGVAGHNSNNNNGM
LTNGNNSVPLYRRQAHTGNGIGGGNGDYNNMHGMDAGANLIEALFQANNSVVDHSVKSSD
HMHGLLYNNFNGLKGGGHELDLFQAMAPSVPHSEAANHHQQSSGSSATTYAAVLSQGPQA
VVGGGVGTGPSPGQSQAQAGVAGSGTGGKVAPAVGRNDLLEKDPFAAIRELGQATTGFYN
YFQ
Download sequence
Identical sequences Q9VUH9
NP_001261848.1.81976 NP_648725.2.81976 NP_996084.1.81976 FBpp0075442 FBpp0075443 FBpp0305287 FBpp0305288 7227.FBpp0075443 FBpp0075443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]