SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0075591 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075591
Domain Number 1 Region: 53-160
Classification Level Classification E-value
Superfamily TPR-like 7.59e-17
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075591   Gene: FBgn0036359   Transcript: FBtr0075857
Sequence length 185
Comment pep:known chromosome:BDGP5:3L:13418991:13419773:-1 gene:FBgn0036359 transcript:FBtr0075857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQANLTLSPHDQQVLDSIFNPLELSSLQTNNLIPAESDLKDEEPDTQAIKASRELELKA
IALSESGELDGALELFQQSLNLAQRASVLNNRAQTLRLAKRDEEALDDLNKALELANDQQ
TRTKCHAHCQRGVLYRKLDNLEAARADFEAAAQLGSKFAREQLVEINPYAALCNQMLRQA
FDQLK
Download sequence
Identical sequences Q9VU70
FR703 FBpp0075591 7227.FBpp0075591 NP_648644.1.81976 FBpp0075591 FBpp0075591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]