SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0075683 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075683
Domain Number 1 Region: 264-383,433-456
Classification Level Classification E-value
Superfamily TPR-like 2.35e-29
Family Tetratricopeptide repeat (TPR) 0.0056
Further Details:      
 
Domain Number 2 Region: 186-301
Classification Level Classification E-value
Superfamily TPR-like 2.25e-23
Family Tetratricopeptide repeat (TPR) 0.0099
Further Details:      
 
Weak hits

Sequence:  FBpp0075683
Domain Number - Region: 79-123
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.0129
Family N-terminal coiled coil domain from apc 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075683   Gene: FBgn0010235   Transcript: FBtr0075951
Sequence length 508
Comment pep:known chromosome:BDGP5:3L:12739716:12743156:-1 gene:FBgn0010235 transcript:FBtr0075951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQMSQDEIITNTKTVLQGLEALRVEHVSIMNGIAEVQKDNEKSDMLRKNIENIELGLSE
AQVMMALTSHLQNIEAEKHKLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLEEEK
KHLEFMASVKKYDENQEQDDACDKSRTDPVVELFPDEENEDRHNMSPTPPSQFANQTSGY
EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLERTSGHDHPDVATMLNILALVYRD
QNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIR
EKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDPNVAKTKNNL
AGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKNKPIWQVAEEREEHKFDNRENTPYG
EYGGWHKAAKVDSPTVTTTLKNLGALYRRQGMFEAAETLEDCAMRSKKEAYDLAKQTKLS
QLLTSNEKRRSKAIKEDLDFSEEKNAKP
Download sequence
Identical sequences A0A0J9RVJ5 M9PF24 P46824
FBpp0075683 FBpp0303945 FBpp0075683 7227.FBpp0075683 FBpp0075683 NP_001261780.1.81976 NP_524049.1.81976 XP_016031628.1.80810 XP_016031629.1.80810 XP_016031630.1.80810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]