SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0075754 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075754
Domain Number 1 Region: 242-336
Classification Level Classification E-value
Superfamily TPR-like 0.0000358
Family Tetratricopeptide repeat (TPR) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075754   Gene: FBgn0036258   Transcript: FBtr0076022
Sequence length 539
Comment pep:known chromosome:BDGP5:3L:12136542:12139215:-1 gene:FBgn0036258 transcript:FBtr0076022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYGGDEYATNSDYYDDYAHTGDPQLDMEYERNYYAARMPDNVKYFLINFCQAIKEGNLYD
IQNMYENTFPQISDHHFDKTAWPEEQEVAAIVDNDKVFLILYKELYYRHIHARIPGGPKL
EQRINSFFNYCDFFNLIISAQNPVMLELPDIWLWELVDEFVYQFQNFAQYRARLTEKSQD
EIQQLCVNHSNEWSILCILNVLHSLVDISNIKKQLEAISQGVDPQTVAGDFGKLSFYKML
GYFSLVGLLRVHSLLGDYYQAIKVLEPIEIHKKSAYSHIPACQISTSYYVGFAYMMMRRY
ADAIRTFSDILLYIQRTKQLYSTRSYQNDQINKQAEQMYHLLAICLVLHPQCIDESIQQV
LREKNYHDAMFKMQCGDLEVFKSFFVFACPRFVSPCPPAVDAPMDDYVKDPMEHQLQVFM
DEVRQQKDLPTTRSYLKLYTTLPLTKLASFIDPNASEDDVSKLLIRLLCFKHKMRNLVWS
KGPSGLEGTFKSGSELDFYIDDDMIHIADTKVSHRYGDFFVRKILKFNDLNRKLKNINI
Download sequence
Identical sequences Q9VTU4
FBpp0075754 FBpp0075754 7227.FBpp0075754 FBpp0075754 NP_648553.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]