SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0075759 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075759
Domain Number 1 Region: 58-130
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.88e-21
Family Cold shock DNA-binding domain-like 0.0000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075759   Gene: FBgn0022959   Transcript: FBtr0076027
Sequence length 352
Comment pep:known chromosome:BDGP5:3L:12114780:12118256:-1 gene:FBgn0022959 transcript:FBtr0076027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADAAESKPLAAEQQQAQQQPEQQQNPPNPQEQDHEQEPLDELQGQQGQPAPPTKEVIAT
KVTGTVKWFNVKSGYGFINRNDTREDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGE
KGNEAANVTGPSGEPVRGSQFAADKRRNFRPWMKKNRRKDGEVEGEDAESSAQQQQQQAA
PIVDGQPQQQVQSGPRQPRQNFRRGPPGGPPGGPRGGPRGPPGGAPGGPRRYNNYYLRQP
RRGLGGGDGSAEPGVHDQNPEGLQRGEGQGPRRGGGPPGGPQRRFFRRNFNNGPPPPRRD
GGEYIQGQGPPRPQQPRPRRQRKPNGPGGGSEQQPEKNGAQELQNTTTESTA
Download sequence
Identical sequences Q95RE4
7227.FBpp0075759 NP_524033.2.81976 FBpp0075759 FBpp0075759 FBpp0075759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]