SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0075787 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075787
Domain Number 1 Region: 1382-1714
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.73e-65
Family Ankyrin repeat 0.0000358
Further Details:      
 
Domain Number 2 Region: 1736-1844
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000709
Family Tetratricopeptide repeat (TPR) 0.0045
Further Details:      
 
Domain Number 3 Region: 858-910
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000975
Family RecA protein-like (ATPase-domain) 0.091
Further Details:      
 
Weak hits

Sequence:  FBpp0075787
Domain Number - Region: 319-369
Classification Level Classification E-value
Superfamily RING/U-box 0.000106
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number - Region: 883-941,984-1036
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000335
Family RecA protein-like (ATPase-domain) 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075787   Gene: FBgn0041096   Transcript: FBtr0076055
Sequence length 1900
Comment pep:known chromosome:BDGP5:3L:12001324:12049534:-1 gene:FBgn0041096 transcript:FBtr0076055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSLQQIALAMEGDQSELQTPPLPINPPPKVMANGIVYGFRTRHLSCIEENDSDSLHGSS
IPHAYDMMQQADETFQKLNANEEQDESGSEDGGLENLDDTIAMIDESRLLEADYLDELVA
EEQLQEQDEDEEESSDLVDSGNVEEDFWQPSFNRNDIMMTSVYGALNGSLTSEVSSTAAP
GYSECATPRKEAEPVYATPEKRRASNRSFDSTCASLTSSLYGGSMNSSLDLKYSSLGGGD
SVSGGISGTSTLRGTSVPPMDLSMISSDGVSALDWGSASVSCVLDSGDGNPAEELNEEMA
AKCLSAAESDLQSIRRLLEHDASGSVCPSCRISFDKGKRRKLIDTCGHERCYSCMFRNDQ
CPMCMNSSLKDVDGANAQGYDTGIGGSTSTIVSPLGSPQPQLRSHAQRNAALARYMQQHR
QESQSPDYHHRYASNGKLPRAAALSTNGNGFTTGTTQTVTVDVHHQLGGGGGGAAAAAKQ
LMANGISGHSRSSSMSHNIHAAAYSELSAAPPAFATPPTRRRFFNHKNLRSALTGGSGGG
SGVGGGVGGAGGVGGGHRRTASNGGCPIDTASILSGDHTHQHHHRDNQPEGKESNALNTS
TCSDSAVTRRRRKNVSNHNLKTSARHGASSENRLNRLSLAGTSVYAGHLSSLVFGKIKSL
WSVNSSNSSEAGLNQLAGSDAIDHHSSFLNEKLQKDQLHARLGLLLNDPGSNGNSSSSGS
GCEPISAHSTTSTTSSSGVGAASTTTSGSSQNVSPEQTLASGAGMLSGSQLSVATSHGVK
EDALSLCGKFKAGCSMLHVYEALPSKSRKGNVRRSTRGQQGSSSSASAASAVGSRVTASS
LAAVQLALKPLFFEVPLQEPDPPYVGRQWLVQQLSNILLGTETRVVLINGQPGTGKTAFC
LQLVEYSCFGRRQMQDDPDGIYSQLQLGAHCERMRGLASHMVGYHFCQADANLTCQVPDF
VHSLAAQLCQAPQLTAYRDYLLSEPHLQDILSVRECIADAERVMKLAILEPLAHLHRAGK
IPAKVAVIVVDALCEAEYHRPDHGHTIASFLAQLTPHFPAWLKLVATVRTQMLELVKAPS
YTQLTLDSWASSQALQQDMLDYIGARLADSPEIRMNIGGGGGQNSQSGSQPQTKFVSHLQ
SLSRGSMLYAKLILDLIARGQLVIKSSSYKVLPVSLAQIFLLHFNLRFPTARSFEQAAPI
LNICLAALYPLTLDEIYYSMEALSHGREALSWPDFMQRFKLLDGFLIKRLDNTYMFFHSS
LREWLMRRDEGESNKFLCDARLGHAGIAFRLSRLQAPLSPQLTLELGHHMLKAHLYGGTS
LTLLSPRDLQSYWLAGAADNISSSLGALRNVYSPNLKVSRLVLLAGASPNHRTDYMGGAP
ILCIAAHEGILPMVSLLLEFGADVGLTNSQGCTPLILAAMRGHCDVVRPLVAAGSSLGQL
DITQRCALVHAARMGHLSVVKYLLACDWSPRPHSQDVTRSVALQQALIGAAAQAHCKILE
DLLDLNETEFDLDVNGMEPSSGELALTAAARHGCIDVVGILLSRGAQIDARNRQGYSALW
LAVKEGHWSVVEHLLQRGALLDEPLGQTRKTPLMIAAEEGHLELVDLLLARGAQREAQDH
EGFTALSWACLRGHLAAAKTLIEHGCNRHHEDHNGRTALDLAAYQGAASLVIYILEQGGN
LEHIDVHGMRPLDRAIACRNIQAVQVFLRKGAKLGPTTWSMAMGKPEILVILLNKLLEDG
NVLYRKNRFQEAAHRYQYALRKISGLEQLLERNAIFAQLRTNLLLNLSRCKRKLNELDAS
IDLATQAIAQKPHSYEGYYARAKARMELGALNEALVDANEAMQQAAQSGVLCEVVEVLKR
IQTELLTRISISSEDQTGRMSNIGGGASVAYESHHEITDL
Download sequence
Identical sequences Q9VTS9
FBpp0075785 NP_729778.1.81976 7227.FBpp0075785 FBpp0075785 FBpp0075787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]