SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0076113 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0076113
Domain Number 1 Region: 9-188
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.13e-59
Family Cyclophilin (peptidylprolyl isomerase) 0.00000442
Further Details:      
 
Domain Number 2 Region: 229-374
Classification Level Classification E-value
Superfamily TPR-like 1.86e-24
Family Tetratricopeptide repeat (TPR) 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076113   Gene: FBgn0036020   Transcript: FBtr0076384
Sequence length 383
Comment pep:known chromosome:BDGP5:3L:9621776:9624895:1 gene:FBgn0036020 transcript:FBtr0076384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEERKLLRAVKSTNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTL
GKPLHYKGTKFHKIKRVFVVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMAN
YGKPNSNNSQFFISAAGCENLNGTNVVVGRVLRGLGIVAEMEQNCTDEGDPTAPIVIRDC
GEIAHNEDWGIECNDETTDKLPAYPQDWPRKLDKFTGDGAVELLTGIRQSGNHFYQLGRY
HEARAKYRKANRYYHYLSRQFGWQQLNPLKKHLVDEDLLKVDGFSVVNNINAAAVDLKVG
NYTSAREVCNEAIRLDPKCSKAFYRRAQAQRGLRNYEEAINDLKTAHNLLPENKQILNEL
NSTKQLLAQYNRQQRNALKNLFA
Download sequence
Identical sequences Q9VT21
7227.FBpp0076113 FBpp0076113 FBpp0076114 FBpp0076115 FBpp0305988 FBpp0076113 FBpp0076114 FBpp0076115 NP_001261636.1.81976 NP_648338.1.81976 NP_729517.1.81976 NP_729518.1.81976 FBpp0076113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]