SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0076244 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0076244
Domain Number - Region: 153-204,433-465
Classification Level Classification E-value
Superfamily TPR-like 0.00294
Family Tetratricopeptide repeat (TPR) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076244   Gene: FBgn0035947   Transcript: FBtr0076517
Sequence length 604
Comment pep:known chromosome:BDGP5:3L:8968148:8970510:1 gene:FBgn0035947 transcript:FBtr0076517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVQEDNPNTGDVQEKTETAPVAEPSKIFTVEILHMIKDAQQQHGLRHGDFQRYRGYCSR
RIRRLRKALKYPQGDKRHFKRRDVTIGQLTGKKADERFIHIPLICAERAWAYAMQLKQES
NTEPRKRFHLVNKLRRACFYALQLQELCNTEAFDARTKLECEAYVAWMHGTLHFELQLWK
TAGEHLKRAQVVYENLGKALPEDEQELYRAKVNEFTPNLRYCAYNISGGASGGKIDEILE
LRAQGVLENLDVLVSQTKTESSEGLQTIDWRGRKVTVRPEKVRLFLLSAQELDKSLAKTT
KQDAKIELIERILMDCKDAIQAVRDEIKQDPKLRSLTTGQTVSGVQYLLAYLSYIRHSRT
LQRNLCLVEQAKLNFYDPNLQSQQNVGDGKRVRPQDLARLYEIILQNVTEMQQINGLEDD
ATYQSEVENLAITFKAFRCYYIALTLIDIKKWKEAVALYERASNYATEALKGKSSPEFQL
QEELKKVVSAIDGCKFSAHAYSVLEDDNSEESGTTTKSQKTTKPLYERLSLYKEDQSLHT
KAPNVFKLTPDMEPIPCKPIFFDLAMTYVELPSLEGKLESPGKKGASITGFVKGFLGWGG
GGNK
Download sequence
Identical sequences Q9VSS2
NP_648273.1.81976 FBpp0076244 7227.FBpp0076244 FBpp0076244 FR544 FBpp0076244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]