SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0076312 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0076312
Domain Number 1 Region: 17-91,135-300
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.18e-64
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.0034
Further Details:      
 
Domain Number 2 Region: 342-640
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.05e-40
Family Extended AAA-ATPase domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076312   Gene: FBgn0020633   Transcript: FBtr0076585
Sequence length 720
Comment pep:known chromosome:BDGP5:3L:8884690:8887410:1 gene:FBgn0020633 transcript:FBtr0076585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRDYAQDRESIKTFLSEFCKCDDDGKKEFVYGSQLVKLAHREQVLITIDLDDLAEFNE
SLAEAVVDNCRRYTSIFSDVIAELLPSYKQQEVHAKDALDVYIEHRLMMESRTRNPMEQR
DERNSFPSELMKRFEVGFKPLSTEKAHSIREVKAQHIGKLVTVRGIVTRCTEVKPMMVVA
TYTCDRCGSETYQPVNSLSFTPVHDCPSDDCRVNKAGGRLYLQTRGSKFVKFQEVKMQEH
SDQVPVGHIPRSMTIMCRGEVTRMAQPGDHIVVSGVFLPLMRTGFAQMIQGLLSETFLQA
HRIICINKNDEISDKDAELTPEELEELAQDDFYERLATSLAPEIYGHLDVKKALLLLLVG
GVDKRPDGMKIRGNINICLMGDPGVAKSQLLGYISRLAVRSQYTTGRGSSGVGLTAAVMK
DPLTGEMTLEGGALVLADQGVCCIDEFDKMADQDRTAIHEVMEQQTISIAKAGIMTTLNA
RVSILAAANPAFGRYNPRRTVEQNIQLPAALLSRFDLLWLIQDKPDRDNDLRLAKHITYV
HSHSKQPPTRVKALDMNLMRRYINLCKRKNPTIPDELTDYIVGAYVELRREARNQKDMTF
TSARNLLGILRLSTALARLRLSDSVEKDDVAEALRLLEMSKDSLNQIHEHQKGHVPNTSD
RIFAIVRELAGSGKAVKISDIMDRCTTKGFKPDQVDKCIDDYEELNVWQVNMGRTKITFM
Download sequence
Identical sequences Q9XYU0
FR546 7227.FBpp0076312 FBpp0076312 FBpp0076312 NP_523984.1.81976 FBpp0076312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]