SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0076384 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0076384
Domain Number 1 Region: 181-254
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.94e-17
Family Cold shock DNA-binding domain-like 0.0000926
Further Details:      
 
Domain Number 2 Region: 777-854
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000201
Family Cold shock DNA-binding domain-like 0.0047
Further Details:      
 
Domain Number 3 Region: 523-608
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000032
Family Cold shock DNA-binding domain-like 0.002
Further Details:      
 
Domain Number 4 Region: 937-1008
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000198
Family Cold shock DNA-binding domain-like 0.0029
Further Details:      
 
Domain Number 5 Region: 341-394
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000223
Family Cold shock DNA-binding domain-like 0.0022
Further Details:      
 
Weak hits

Sequence:  FBpp0076384
Domain Number - Region: 286-339
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.053
Family Cold shock DNA-binding domain-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076384   Gene: FBgn0035895   Transcript: FBtr0076661
Sequence length 1057
Comment pep:known chromosome:BDGP5:3L:8427149:8431786:-1 gene:FBgn0035895 transcript:FBtr0076661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTQSKVYRTGEEIYDNLPCDSYFNMNAIRNLGIPTTFPTIGTFTLDSTTLGLQPQGQGP
SPQQQQHQQQQQQQQQQHQQNMHHHQHQQQHMQQQQQQQQHQQQHQQQQHQQQQQHQQQQ
QQQQQHPTIGMFDANEVNDVIQNPPQIGVFQSNSVLTNGAGSGSSIFGSQSSNSSAAAAD
PSQTTRETGIIEKLLHSYGFIQCCERQARLFFHFSQFSGNIDHLKIGDPVEFEMTYDRRT
GKPIASQVSKIAPEVVLSEERVTGTVTTELRTDSANNVLNSSETTGRISYENRGECFFLP
YTKDDVEGNVNLRAGDKVSFQIATNQRGNLGACHIRLENPAQPVKYRGVVCSMKESFGFI
ERADVVKEIFFHFSEAEGNVELRPGDDVEFTIQTRSVSGSGDPTNPNMLQSKMQSASVPP
QGREFACNITRLAPGSVIFEDVDSTVYKGQVLKSLDRNNPVRQNNDPLPGRIRYRALDYS
EVEVPFGDKDQKGDFTLRHGDWVQFLLATDRRDQLQRATSIALLDETFKVSGEKREQGTI
ASLKEGFGFLRCVERQARLFFHFTEVLDTSREIDINDEVEFTVIQEPGLAYNNSRLQAIR
IKHLPPNSVQFETLVASNIEGCVTREAPKSPIKSQDRVEGGVITYEHADVKKTIMYFLKD
CEKPPRIGERVRFDIYMVKRNKECIAVNVQQVSLHQQQQQQQQQLHLNQSNAGANINQND
QLGGLSNGISSSSSNASLQNGYVMHGSPGGSTSSVGSNNPVHLDEFKMENNNHAGSDAGQ
VYRGFIAVMKENFGFIETLSHDEEVFFHFSNYMGNPNWLELGQEVEYTLARNGNTSVSGN
CLPAENVRMLPKNSIPQPAVLETTHNGVVARPLRCINPDQQEYAGLIEILDELRTTVISQ
HEFGITSLVNKRDLLQKGDLVSFRIDESGRAACVNAVRQKKRATVDSIKGQFGFLNFEVE
DGKKLFFHMSEVQGNTVALHPGDTVEFSVVTNQRNGKSSACNVLKINDRPDRLISRLKLN
GDDTVPRLILIRAPKGPQGKGFSVLARHPRIPGNLVE
Download sequence
Identical sequences B7Z0E2
FBpp0113084 NP_001137912.1.81976 NP_001261579.1.81976 NP_001286983.1.81976 FBpp0076384 7227.FBpp0113084 FBpp0113084 FBpp0305200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]