SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0076407 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0076407
Domain Number - Region: 263-379
Classification Level Classification E-value
Superfamily TPR-like 0.0252
Family Tetratricopeptide repeat (TPR) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076407   Gene: FBgn0027549   Transcript: FBtr0076684
Sequence length 702
Comment pep:known chromosome:BDGP5:3L:8103363:8106427:1 gene:FBgn0027549 transcript:FBtr0076684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSARMLKKLQGDADKLAPPPDDEDCEELSDNDELEDSDMQRYRKSHLNPFDLLNQAGLSL
SESEFKEDDNETEHPSAALPNATASAAKKKKKKRKKKAKSSGNHISSEDNERQDKYFEKV
DPLLGKVYDAVPRQSAKQLVSAATGTTATKKLLAVELRHLNPQNEMRRTFGKRVVKVETK
RGRQKPTLKSTYMVTAKDSWPALTKNTITMKLLPAPDSPSVSSKSITDNGADVQWFAFEH
SQYYQGVQQMFLSALERIDSEFLITLIKRCPYHVDSLVQLSEVCKMTEDFSLASELLERA
LLLLESSLHINFSLTSGNCRLDYRRQENRSFYIVLFKHAQYLEERACSRTAFEISKLLLS
LQPDTDPLAMILVIDYYALRSKQFEWLVEFYEKYNAARNLNQLPNMAYSYALALHTLYGA
CERSNQALQYALLMFPGVLRPLLDEMSVQTDKRVLASSYFFADVSGNQSPALHQLVCLYV
CRARVVWRQNEVLPWLESNVNIVLDRIESKDPLVNEYKEKRSLRYSGTPPRPILRHVILS
DYKEKVPLAVFVSKEKQAIMTYDPLPPPNSVNCYHRKSSSSSSPTTNTNNSVSMFFQSLL
PSFNINNLAANAQLQEGAAPAAGAGAAAGDANIEVGIEQGAAGVAGEGEEAGLQQSLTLM
MDAMRDFLQNFRIAEHLRSPETAAAQSTSSNDEEEGSSDYID
Download sequence
Identical sequences Q9Y109
FBpp0076407 FBpp0076407 7227.FBpp0076407 FBpp0076407 NP_001261558.1.81976 NP_648174.3.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]