SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0076446 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0076446
Domain Number 1 Region: 98-167
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.7e-21
Family Chaperone J-domain 0.00054
Further Details:      
 
Domain Number 2 Region: 340-424
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.0000000000000432
Family HSP40/DnaJ peptide-binding domain 0.0026
Further Details:      
 
Domain Number 3 Region: 220-299
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 0.0000000000262
Family DnaJ/Hsp40 cysteine-rich domain 0.0013
Further Details:      
 
Weak hits

Sequence:  FBpp0076446
Domain Number - Region: 207-241,303-318
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.0133
Family HSP40/DnaJ peptide-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076446   Gene: FBgn0035852   Transcript: FBtr0076723
Sequence length 449
Comment pep:known chromosome:BDGP5:3L:8184622:8186216:-1 gene:FBgn0035852 transcript:FBtr0076723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRLKLFRSPGDVLSTLISGAATDCCRKTSHCLELDRAPAVAACWICMRMISQYQFRTTK
PAYYPDRQREAKRTSAGATPQQVSSPAVKYPQSRGMPKDYYYKVLGVNRHATIQQIRSAF
YALAKRYHPDSTHSEQKLKHFQELSNAYNILTDETKRLEYDQLGGIKDERAFLEQAGNPL
NVGLEEAKKFDSDKTTNDEINKLKSNEFDLPLDFLEATVGCKKRIELRYLRKCETCKGKS
QLMAHRDVGKEPCRRCNGTGKVMTKTPTFSSVNTCTQCKGKRFTNRNDCETCSNRGFVVS
NVDVMVSVPSGSRDGDVVNIINPETKQQVTYRLSVPSSDYFRRVGNDILTDKHLNISEAI
LGGSFQIRGLYESVELRVEPGTQSHTQVVLNGKGVRSREGVGNHIVTLKVRIPRNLSVKQ
RQLVLALSQAEDPVFEPKTKSTEAGNLSH
Download sequence
Identical sequences Q8SZX1
FBpp0076446 FBpp0076446 FBpp0076446 NP_648186.3.81976 7227.FBpp0076446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]