SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0076526 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0076526
Domain Number 1 Region: 1059-1348
Classification Level Classification E-value
Superfamily RNI-like 9.81e-32
Family 28-residue LRR 0.0023
Further Details:      
 
Domain Number 2 Region: 534-647
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.42e-28
Family Ankyrin repeat 0.00035
Further Details:      
 
Domain Number 3 Region: 11-105,161-243
Classification Level Classification E-value
Superfamily TPR-like 9.21e-17
Family Tetratricopeptide repeat (TPR) 0.027
Further Details:      
 
Domain Number 4 Region: 304-428
Classification Level Classification E-value
Superfamily TPR-like 0.000000000531
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076526   Gene: FBgn0035812   Transcript: FBtr0076814
Sequence length 1405
Comment pep:known chromosome:BDGP5:3L:7714905:7719542:-1 gene:FBgn0035812 transcript:FBtr0076814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEKRYLKRKEKARSDGNRDQVAVSCNQLGDFYNQQGKYTDAVREYVQEAQIYASMGKEL
ETAKAKRMVGEMYTLLCDYDAAKDHINDYLKIAKRLKNQVEEQRAYATLGRVHLLHGQSL
ADSSASGSMEQLKLAEKNFLRSLLLIKDLSGQISKLEQLDMQARCYLNIGVVKEHMEAFQ
ESIEYIDKAIKISKTHELWDLTHLCYISMSLLYICKKNDATAALRFCNMALEVAKRFPNK
VKKICETLITKAEILIKAGDFASAKQILTKAYKKNTPDENDRVNIEKQLRIVVKVCQTLD
ELVLTSSVDYAKLKGLYEKLGDGCCHLMNYEKALTYYQKMLENAELNQESGKSLVPIYVS
LYQTYRDNGQFDKALEYLWKEFELNQDAPSEAFTTLCTIAEICEQQSHPFWTVHDVYQKA
LRQADKAGSCSDKLVKIAMVRLRRLMLKHNMQVLVENLEADATAKGIDLDQEESVGDDEE
ESDGGGTAVQQNTPDWDDDFDLATLTDSDASDLDETEKPRPQRTTRGNRTLVIKKNNKGE
TQLHQACISGNLELVRRLIDQGHTVNVRDHAGWLPLHEACNHGYREIVELLLDKGAASAI
NDKGGTSCDGITPLFDACSNGFLDVAELLLDRGADATVRTDYNETCIAGLDKWRQGAQLV
DGEQAQYAQLRERLLRTLSKVGICSDKNARPLTNFNAKRISREERGSMSEEEDEEEALHE
SNRRSLSHNRSGSEYGAKKSKSSTQPSASKEYRSVMAHLKRPNRLNDDPPSTSTLNKHKR
NAFLSEDEVDADNWLIDDVGPERKRKRINSGDLSRRTSKENFQDTALSLPANWEDDLLQA
TPENEYSQRQKQMRKLTLSRSSSMSSNHSSSATSSRKKHQATLLDSGFSRFRSESPLGSE
SSQDGTTSLISVRTIEPDSTTSTIQVLISPAKSSPIKVQATPVLATTVSFKVKIQDELLL
VPIERKKLQDINIRWLAEEAGRRYNKLTGLTPLLRLKTADGFAYEETDPVSVALEQNMLM
ASILDWKISPLSQRYEEMCLQMQKTVDNKVKLLLERSQNNNMLELSGLWMRAEKTEPIFK
ALLHQARLTVLDLSCNFIGNEGCQQLAKSLPTLLQLKALRLQCNAIGSHGLEALLCGQGM
DKLELLEELNLNQNPLGNASVRILSKYCASPAGQALTCLQLAQCELTELQDFDLGFNKLT
RFDISFNQLTQQSVRRLTDQLNSCRLEQLNLSYVRWPLDDASGFALSERLVTLFEGGTCE
RFVGVQLAGCGLNDAHMYNISQHLAKAKQLQMLDISDNSNLSGTTLGYILDELPQLRDLL
AVNCTNLLDDIRLQKLEQLKQLPRRLELTVDEQVFSMPGALETLQSIWQLQFGDKAKMLT
TSNSRKIGRRYKGLLKLLADGSDAE
Download sequence
Identical sequences Q9VSA4 T2GGE0
FBpp0076526 NP_001303376.1.81976 NP_648150.1.81976 7227.FBpp0076526 FBpp0076526 FBpp0076526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]